CAZyme Information: MGYG000003965_00667

Basic Information

• Lineage: Bacteria; Verrucomicrobiota; Lentisphaeria; Victivallales; Victivallaceae; UMGS1518
• CAZyme ID: MGYG000003965_00667
• CAZy Family: GT19
• CAZyme Description: Lipid-A-disaccharide synthase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
396	MGYG000003965_32|CGC1	44815.47	9.4264

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003965	1994978	MAG	United Kingdom	Europe

• Gene Location: Start: 8960; End: 10150 Strand: -

Full Sequence      

MSAMNDKAPKNIWLIAGETSGEMYGARLATELKDLAAKEGRDLHISGMGGIKMRDAGVDI
LVDSSELDVIGILEVFKHIFTFIRIFKYLVNKAKTERPDAVVLIDYPGFNMMLAKALHKA
GIPVIWYISPQVWAWKKYRIKQLEQYCRKMLVIFPFEVEVYQDTTLDTEFVGHPLLEMVE
ARRDPAIVRDPDTVVLLPGSRSVEINRLLKPMLETATQLKKRHPALKFVLTAPREKIAKR
CQEIYNCFKQRNPDVPDVTILTGETAKYQQLAGTGLAASGTVTVESAIAGLPLVVVYRIN
WISLLIAAPFIKLFRGFFTMANVIADKMVFEEFLQHHVRKEELIPALERVLPGGERRSEV
EQDMANIKKLLSPDNRTGVLKYTAGKIYETVNQNNR

Enzyme Prediction     

No EC number prediction in MGYG000003965_00667.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT19	12	371	1e-104	0.9915254237288136

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK00025	lpxB	2.67e-112	9	396	1	380	lipid-A-disaccharide synthase; Reviewed
COG0763	LpxB	3.54e-103	9	371	1	362	Lipid A disaccharide synthetase [Cell wall/membrane/envelope biogenesis].
pfam02684	LpxB	1.31e-77	12	364	1	351	Lipid-A-disaccharide synthetase. This is a family of lipid-A-disaccharide synthetases, EC:2.4.2.128. These enzymes catalyze the reaction: UDP-2,3-bis(3-hydroxytetradecanoyl) glucosamine + 2,3-bis(3-hydroxytetradecanoyl)-beta-D-glucosaminyl 1-phosphate <=> UDP + 2,3-bis(3-hydroxytetradecanoyl)-D-glucosaminyl-1,6 -beta-D-2,3-bis(3-hydroxytetradecanoyl)-beta-D-glucosaminyl 1-phosphate. These enzymes catalyze the fist disaccharide step in the synthesis of lipid-A-disaccharide.
TIGR00215	lpxB	6.70e-71	4	356	1	350	lipid-A-disaccharide synthase. Lipid-A precursor biosynthesis producing lipid A disaccharide in a condensation reaction. transcribed as part of an operon including lpxA [Cell envelope, Biosynthesis and degradation of surface polysaccharides and lipopolysaccharides]
PRK14089	PRK14089	9.22e-58	61	350	42	316	lipid-A-disaccharide synthase.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QSH40861.1	1.62e-159	4	394	1	389
AVM45461.1	1.09e-154	10	374	12	376
CCO23940.1	2.62e-68	11	392	7	373
QHI67954.1	1.03e-67	10	371	3	358
BCG48537.1	1.31e-66	9	368	5	359

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5W8N_A	1.94e-37	4	354	1	348	LipidA Disaccharide Synthase (LpxB)-6 solubilizing mutations [Escherichia coli BL21(DE3)]
5W8S_A	1.94e-37	4	354	1	348	LipidA Disaccharide Synthase (LpxB)-7 solubilizing mutations [Escherichia coli BL21(DE3)],5W8X_A Lipid A Disaccharide Synthase (LpxB)-7 solubilizing mutations-Bound to UDP [Escherichia coli BL21(DE3)]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q1INL4	1.19e-65	12	371	4	357	Lipid-A-disaccharide synthase OS=Koribacter versatilis (strain Ellin345) OX=204669 GN=lpxB PE=3 SV=1
Q2LVL8	4.82e-61	10	371	4	361	Lipid-A-disaccharide synthase OS=Syntrophus aciditrophicus (strain SB) OX=56780 GN=lpxB PE=3 SV=1
A0L8R9	1.27e-58	9	373	4	365	Lipid-A-disaccharide synthase OS=Magnetococcus marinus (strain ATCC BAA-1437 / JCM 17883 / MC-1) OX=156889 GN=lpxB PE=3 SV=1
B3E4H8	1.57e-58	9	393	6	382	Lipid-A-disaccharide synthase OS=Trichlorobacter lovleyi (strain ATCC BAA-1151 / DSM 17278 / SZ) OX=398767 GN=lpxB PE=3 SV=1
Q74AT9	2.27e-58	4	371	1	363	Lipid-A-disaccharide synthase OS=Geobacter sulfurreducens (strain ATCC 51573 / DSM 12127 / PCA) OX=243231 GN=lpxB PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000055	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003965_00667.