CAZyme Information: MGYG000003969_01303

Basic Information

• Lineage: Bacteria; Proteobacteria; Gammaproteobacteria; Burkholderiales; Burkholderiaceae; CAG-521
• CAZyme ID: MGYG000003969_01303
• CAZy Family: GT9
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
312		34343.78	7.3086

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003969	1767609	MAG	United Kingdom	Europe

• Gene Location: Start: 15784; End: 16722 Strand: -

Full Sequence      

MNPIVVCRLPNHVGDCCMTLPSLRLLEASGFTPYLVGKRFAEDLMLGMGWRFDPIEGHVS
EDLQRLHYLSQQLHNPLGLLFPNSFGSALQFRLAGIRAAGFPTDGRFLLLDKKVPEPEKN
IHEVERFFAATLGAIKAWGKEPAFTEPPKDLGLKLITRHTAGAKNLIEKYGIPEKFALIA
PIARGVHHGKIKHWTHINCVVKPLRELGIEPIVLPSPDEAEDAKVACPDATHLPPTNLGT
YAALCKEAQLVIANDSGISHVAAAVGARQITLVGVTDPKRTGPWNPNAIVLGEENRWPTE
EEVTNKIHELFK

Enzyme Prediction     

No EC number prediction in MGYG000003969_01303.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT9	79	292	8.2e-28	0.8311111111111111

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam01075	Glyco_transf_9	1.19e-30	77	292	15	228	Glycosyltransferase family 9 (heptosyltransferase). Members of this family belong to glycosyltransferase family 9. Lipopolysaccharide is a major component of the outer leaflet of the outer membrane in Gram-negative bacteria. It is composed of three domains; lipid A, Core oligosaccharide and the O-antigen. All of these enzymes transfer heptose to the lipopolysaccharide core.
COG0859	RfaF	3.46e-21	10	290	9	294	ADP-heptose:LPS heptosyltransferase [Cell wall/membrane/envelope biogenesis].
cd03789	GT9_LPS_heptosyltransferase	2.78e-17	3	292	1	241	lipopolysaccharide heptosyltransferase and similar proteins. Lipopolysaccharide heptosyltransferase (2.4.99.B6) is involved in the biosynthesis of lipooligosaccharide (LOS). Lipopolysaccharide (LPS) is a major component of the outer membrane of gram-negative bacteria. LPS heptosyltransferase transfers heptose molecules from ADP-heptose to 3-deoxy-D-manno-octulosonic acid (KDO), a part of the inner core component of LPS. This family also contains lipopolysaccharide 1,2-N-acetylglucosaminetransferase EC 2.4.1.56 and belongs to the GT-B structural superfamily of glycoslytransferases, which have characteristic N- and C-terminal domains each containing a typical Rossmann fold. The two domains have high structural homology despite minimal sequence homology. The large cleft that separates the two domains includes the catalytic center and permits a high degree of flexibility.
TIGR02195	heptsyl_trn_II	1.07e-08	80	283	85	287	lipopolysaccharide heptosyltransferase II. This family consists of examples of ADP-heptose:LPS heptosyltransferase II, an enzyme of LPS inner core region biosynthesis. LPS, composed of lipid A, a core region, and O antigen, is found in the outer membrane of Gram-negative bacteria. [Cell envelope, Biosynthesis and degradation of surface polysaccharides and lipopolysaccharides]
PRK10422	PRK10422	4.58e-08	117	302	134	319	lipopolysaccharide core biosynthesis protein; Provisional

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QQS89241.1	1.33e-140	2	310	3	312
QDA55160.1	1.84e-139	5	310	4	309
BBF22597.1	3.13e-138	1	311	1	311
ANU65198.1	1.25e-111	8	311	7	309
QQQ96353.1	1.25e-111	8	311	7	309

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000064	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003969_01303.