CAZyme Information: MGYG000003970_01607

Basic Information

• Lineage: Bacteria; Firmicutes_A; Clostridia; Lachnospirales; Lachnospiraceae
• CAZyme ID: MGYG000003970_01607
• CAZy Family: GH127
• CAZyme Description: Non-reducing end beta-L-arabinofuranosidase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
637	MGYG000003970_216|CGC1	72476.38	4.9522

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003970	3341610	MAG	United Kingdom	Europe

• Gene Location: Start: 2453; End: 4366 Strand: -

Full Sequence      

MYNKKVLKSPGIAQVKLTGEYWPRIQEMFRDKVLEKQWRILNGEVEIENVGRSHCVDNFR
IMAGDMTEKFSGSYWFSDHELGKWMEAAAYGLALGAGEHIREHMEYAIDLLERAQGEDGY
LNTYYTLYEPGKRFTNFTTGHELLNAGNFLEAGIAYYLTGGGRRLLDITIRYIDLIHDTV
MSADHPIYDGHEEIEIALIKLYLLCGEEKYLNLARRFVDTRGVGRCLFLDEDSVRLPDVG
LEYYQAHQPVREQKDALGHAVRATYLYTAMAELVAVARDETLLEPVRTLWEDITKRKIYI
TGGIGSEHHGERFTSAYDLPNDSAYSETCAGIGLMMFARALLKLQPEAAVADQMEKALYN
TVLSGISVDGEHYFYVNPLSMKPSTAVYRQALWQVRTKREEWMLCPCCPPNLARLILSLN
DYLYVVDDDRIYLNLLISNELELERGGKKEKLHVEGNEPWGGTLRVTAESDITGTVYLKK
PYWSEKAVVRLNGVGCTCECEDGYLALKELKRGDCAEIVFDMQARLVYANPHVDADCGKA
AVEKGYLVYCAEQADNGEDLSAITVETDQPLQVYDSCEGRLGGELHRIRLNGRKMRPTES
LYTFERPRTDSVAVELIPYYLWNNRGEGEMAVWLNAR

Enzyme Prediction     

No EC number prediction in MGYG000003970_01607.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH127	15	550	4.7e-172	0.9980916030534351

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG3533	COG3533	4.46e-153	6	637	3	588	Uncharacterized conserved protein, DUF1680 family [Function unknown].
pfam07944	Glyco_hydro_127	9.98e-123	14	550	1	503	Beta-L-arabinofuranosidase, GH127. One member of this family, from Bidobacterium longicum, UniProtKB:E8MGH8, has been characterized as an unusual beta-L-arabinofuranosidase enzyme, EC:3.2.1.185. It rleases l-arabinose from the l-arabinofuranose (Araf)-beta1,2-Araf disaccharide and also transglycosylates 1-alkanols with retention of the anomeric configuration. Terminal beta-l-arabinofuranosyl residues have been found in arabinogalactan proteins from a mumber of different plantt species. beta-l-Arabinofuranosyl linkages with 1-4 arabinofuranosides are also found in the sugar chains of extensin and solanaceous lectins, hydroxyproline (Hyp)2-rich glycoproteins that are widely observed in plant cell wall fractions. The critical residue for catalytic activity is Glu-338, in a ET/SCAS sequence context.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ANF96932.1	6.03e-172	3	634	4	649
AWV33221.1	1.64e-169	3	634	7	649
AGT32221.1	4.94e-169	11	637	4	640
AIQ29277.1	7.68e-169	14	634	10	646
AIQ23432.1	2.32e-168	1	634	1	645

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4QJY_A	3.24e-166	13	637	14	648	Crystalstructure of native Ara127N, a GH127 beta-L-arabinofuranosidase from Geobacillus Stearothermophilus T6 [Geobacillus stearothermophilus],4QJY_B Crystal structure of native Ara127N, a GH127 beta-L-arabinofuranosidase from Geobacillus Stearothermophilus T6 [Geobacillus stearothermophilus]
4QK0_A	2.09e-161	13	637	14	648	Crystalstructure of Ara127N-Se, a GH127 beta-L-arabinofuranosidase from Geobacillus Stearothermophilus T6 [Geobacillus stearothermophilus],4QK0_B Crystal structure of Ara127N-Se, a GH127 beta-L-arabinofuranosidase from Geobacillus Stearothermophilus T6 [Geobacillus stearothermophilus],4QK0_C Crystal structure of Ara127N-Se, a GH127 beta-L-arabinofuranosidase from Geobacillus Stearothermophilus T6 [Geobacillus stearothermophilus],4QK0_D Crystal structure of Ara127N-Se, a GH127 beta-L-arabinofuranosidase from Geobacillus Stearothermophilus T6 [Geobacillus stearothermophilus]
6EX6_A	1.87e-113	13	634	13	623	TheGH127, Beta-arabinofuranosidase, BT3674 [Bacteroides thetaiotaomicron VPI-5482],6EX6_B The GH127, Beta-arabinofuranosidase, BT3674 [Bacteroides thetaiotaomicron VPI-5482]
3WRE_A	1.04e-111	15	633	3	655	Thecrystal structure of native HypBA1 from Bifidobacterium longum JCM 1217 [Bifidobacterium longum subsp. longum JCM 1217],3WRG_A The complex structure of HypBA1 with L-arabinose [Bifidobacterium longum subsp. longum JCM 1217]
3WKW_A	1.40e-111	15	633	3	655	Crystalstructure of GH127 beta-L-arabinofuranosidase HypBA1 from Bifidobacterium longum ligand free form [Bifidobacterium longum subsp. longum JCM 1217],3WKX_A Crystal structure of GH127 beta-L-arabinofuranosidase HypBA1 from Bifidobacterium longum arabinose complex form [Bifidobacterium longum subsp. longum JCM 1217],7BZL_A Chain A, Non-reducing end beta-L-arabinofuranosidase [Bifidobacterium longum subsp. longum JCM 1217],7DIF_A Chain A, Non-reducing end beta-L-arabinofuranosidase [Bifidobacterium longum subsp. longum JCM 1217],7EXV_A Chain A, Non-reducing end beta-L-arabinofuranosidase [Bifidobacterium longum subsp. longum JCM 1217],7EXW_A Chain A, Non-reducing end beta-L-arabinofuranosidase [Bifidobacterium longum subsp. longum JCM 1217]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
E8MGH8	5.72e-111	15	633	3	655	Non-reducing end beta-L-arabinofuranosidase OS=Bifidobacterium longum subsp. longum (strain ATCC 15707 / DSM 20219 / JCM 1217 / NCTC 11818 / E194b) OX=565042 GN=hypBA1 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000077	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003970_01607.