CAZyme Information: MGYG000003972_01444

Basic Information

• Species: QALW01 sp003150515
• Lineage: Bacteria; Firmicutes_A; Clostridia_A; Christensenellales; QALW01; QALW01; QALW01 sp003150515
• CAZyme ID: MGYG000003972_01444
• CAZy Family: CBM67
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
878	MGYG000003972_51|CGC1	99991.27	5.3192

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003972	1977806	MAG	United Kingdom	Europe

• Gene Location: Start: 2955; End: 5591 Strand: -

Full Sequence      

MINSNLLAYCEYTSNPLGVNSKTPRFSWRIENCPRMQTAYRVRVALSQQELEQDSLLWDS
GMLSGSENKCRYAGPELSSARLYFFDVQVWCGSDSFKSGAQHFLTALYNQEDWQGRFIGY
KDYKKRENYMLVKKFRIRKNIEHAYAYICGPGYSELYINNSKIGDNVLEPGWTDYNRRVL
YSVYDVTENIQKGANLISVMLGEGWLGHEHTFFMKIFGTNPSWLGTPCLLMNLLLFYSDG
TTETIYTDEGLKWYAAKGPVIMNNIYDGETYDARMEIKLPEGEEFRAQKPFEPAIAVQGP
KGALYRDLLPPIKRFEKLRARTVYRPTADSMTIDFGKNIAGWVKLRVRGEAGSKIVVKYS
ETINSDFSVNQENLRNARAMDEYILKGEGIEEYEPRFTYHGFRYAQIFVQSSCSLLNATA
YRVNSSVSRTGWFSCDNQMLNDIYDTIVSTERNNLHSIPTDCPQRDERLAWLNDMTVRFE
EAMYNYDMLLFYEKWLRDIKDAQDGGQNGEIGDTAPYFYGGRPACHISSVYVLLPYFIYL
FYNDDTALKEHYEGMKKYTGFMLSQLDERGLMASGYVGEWAPPLSESAFSTTWDALPANI
DNQLVTTCYLYYCLTVMQKSAQHLNLDDQGQFYAQKAAELKDNINSAFFDRNGYYVPFSQ
GSNVFPMFLGIIPLGADYLIANMLIEDIVQENECHVTTGSQLTKYLFEVLNLIKRNDIGV
QILSKKDYPSIGYMLANGATSLWERWENTTGDTMNSHNHPMQGAFCPWFFKALAGIIPYT
LPEKGYITIAPDFTAALNKVEASVQLAAGKVSSAWERQGGTVKFTLSLPFNTKAHVIIPL
LGLEPSQLSMNGSKYTGKSTNGTAEYMLEAGEYIFNLG

Enzyme Prediction     

No EC number prediction in MGYG000003972_01444.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH78	327	837	2.9e-136	0.9880952380952381
CBM67	124	277	9e-20	0.7784090909090909

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam17389	Bac_rhamnosid6H	2.18e-88	428	773	1	340	Bacterial alpha-L-rhamnosidase 6 hairpin glycosidase domain. This family consists of bacterial rhamnosidase A and B enzymes. L-Rhamnose is abundant in biomass as a common constituent of glycolipids and glycosides, such as plant pigments, pectic polysaccharides, gums or biosurfactants. Some rhamnosides are important bioactive compounds. For example, terpenyl glycosides, the glycosidic precursor of aromatic terpenoids, act as important flavouring substances in grapes. Other rhamnosides act as cytotoxic rhamnosylated terpenoids, as signal substances in plants or play a role in the antigenicity of pathogenic bacteria.
pfam08531	Bac_rhamnosid_N	4.10e-49	139	316	1	172	Alpha-L-rhamnosidase N-terminal domain. This family consists of bacterial rhamnosidase A and B enzymes. This domain is probably involved in substrate recognition.
pfam05592	Bac_rhamnosid	2.47e-30	333	407	10	84	Bacterial alpha-L-rhamnosidase concanavalin-like domain. This family consists of bacterial rhamnosidase A and B enzymes. L-Rhamnose is abundant in biomass as a common constituent of glycolipids and glycosides, such as plant pigments, pectic polysaccharides, gums or biosurfactants. Some rhamnosides are important bioactive compounds. For example, terpenyl glycosides, the glycosidic precursor of aromatic terpenoids, act as important flavouring substances in grapes. Other rhamnosides act as cytotoxic rhamnosylated terpenoids, as signal substances in plants or play a role in the antigenicity of pathogenic bacteria.
pfam17390	Bac_rhamnosid_C	2.02e-09	786	839	11	64	Bacterial alpha-L-rhamnosidase C-terminal domain. This family consists of bacterial rhamnosidase A and B enzymes. L-Rhamnose is abundant in biomass as a common constituent of glycolipids and glycosides, such as plant pigments, pectic polysaccharides, gums or biosurfactants. Some rhamnosides are important bioactive compounds. For example, terpenyl glycosides, the glycosidic precursor of aromatic terpenoids, act as important flavouring substances in grapes. Other rhamnosides act as cytotoxic rhamnosylated terpenoids, as signal substances in plants or play a role in the antigenicity of pathogenic bacteria.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QGA22854.1	1.55e-189	10	839	39	852
AHF90970.1	4.44e-180	9	839	12	845
VEH16339.1	2.15e-179	11	839	40	854
QEC51112.1	1.50e-175	11	875	77	937
AEE97752.1	2.07e-175	10	852	13	862

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6I60_A	1.79e-174	10	841	37	901	Structureof alpha-L-rhamnosidase from Dictyoglumus thermophilum [Dictyoglomus thermophilum H-6-12],6I60_B Structure of alpha-L-rhamnosidase from Dictyoglumus thermophilum [Dictyoglomus thermophilum H-6-12]
3W5M_A	3.99e-96	131	877	305	1030	CrystalStructure of Streptomyces avermitilis alpha-L-rhamnosidase [Streptomyces avermitilis MA-4680 = NBRC 14893],3W5N_A Crystal Structure of Streptomyces avermitilis alpha-L-rhamnosidase complexed with L-rhamnose [Streptomyces avermitilis MA-4680 = NBRC 14893]
6GSZ_A	1.21e-91	11	855	10	863	Crystalstructure of native alfa-L-rhamnosidase from Aspergillus terreus [Aspergillus terreus]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
T2KPL4	1.58e-126	14	878	41	943	Alpha-L-rhamnosidase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_22170 PE=2 SV=1
Q82PP4	1.78e-95	131	877	305	1030	Alpha-L-rhamnosidase OS=Streptomyces avermitilis (strain ATCC 31267 / DSM 46492 / JCM 5070 / NBRC 14893 / NCIMB 12804 / NRRL 8165 / MA-4680) OX=227882 GN=SAVERM_828 PE=1 SV=1
T2KNB2	2.84e-94	7	839	38	879	Alpha-L-rhamnosidase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_22090 PE=1 SV=2
P9WF03	1.65e-90	15	839	42	879	Alpha-L-rhamnosidase OS=Alteromonas sp. (strain LOR) OX=1537994 GN=LOR_34 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000037	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003972_01444.