CAZyme Information: MGYG000003974_00074

Basic Information

• Species: CAG-452 sp900770415
• Lineage: Bacteria; Firmicutes_A; Clostridia; TANB77; CAG-508; CAG-452; CAG-452 sp900770415
• CAZyme ID: MGYG000003974_00074
• CAZy Family: GT84
• CAZyme Description: Cyclic beta-(1,2)-glucan synthase NdvB

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
1436		166665.67	6.7101

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003974	1320335	MAG	United Kingdom	Europe

• Gene Location: Start: 68743; End: 73053 Strand: -

Full Sequence      

MLAIVSAYDLKYIELEDAIERINKTLETIQKLQKWNGHLYNWYNTQTLEPLNPRYVSTVD
NGNFIGYLYTVKQFLINAEKNLKVSAPNTSEYIEKINQMIQIIDNIIQSTDFSVLYNPKK
RLFSIGFNIEENKLTNSYYDLLASEARQASLVAIAKKDIPSKHWNSLSRTLTSLKKYKGL
VSWSGTAFEYLMPNINIEQYEGSLLDEACRFLIMSQMEYAKKLGIPFGISEAAFNLRDLN
NNYQYKAFGIPWLGLKRGLEDDMVVSPYSVFLSLNYVPKQGIENLKLLENEGMNSKYGFY
ESIDYTLSRLKYGKKYETVKTYMAHHQGLSLLSINNLINKNILVKRFMKNPEIEGIKILL
QERMPEKAIITKEKKEKVEKLKPKDYENYTEQTYTKVNYELNEVNTISNGNYTICTKSNG
EGFSKYKGILINRFKETADKKQGIIFYIKNVSNKRIWTNIPIDKKQDKLKVSFTPSETKF
TRTDGNIETKTKIIACANDPVEIRRLELKNNGNMEETLEITNYFEPVLSKPEQDYAHQAF
NNLFITFENLEKDNILVKRKKRGVKDKDIYLAVNLYTEHETVGDFEYEISQEKFLGKRNT
LIPELVEDSKPYSKTMGLVTEPCLATKRTIKIKPSETIIIELILSISNNREEAISALEKY
KNEKIITKAFEVSRAKVEAENIYLGLKGKEVETYQKLLSYLLFHNPLRKLVLEKLPKRIY
SQSKLWKYGISGDLPILLLEIKDINDIYVVKECLKAYEFFRNKDIKIDLVIINEEPNSYD
SYLKYEIEDAIIDKQLAYLKNIFGGIFTICKNEIDLEDIDLLKFKASVFLKAESGSLETA
ITDLEEEYLKTIKNIGIEENEPIVETEKEEELEENMEELKYYNEYGGFSENGLEYKIKIG
KDNKLPTAWSMILANPKFGTLVTQNIGGFTWHKNSRLNRLSAWNNEPVLDIPSEIIYLKD
KENGKKWSLSNNLNDIQTNSYITYGLGFVNFKNIYNGIYQELNIFVPKEDTVKINILKLK
NLNSKKRKLKLLYYIKDVFGEDEIKTNGNIQLVKETNVIFANNLYKDSFKRCIPYITTSE
NIKSYTGDKKSFIGNQSIKNPIALDLVSLDNSSGLGQNSCIAIELEVELEGYESKEISIV
FGEEESKLDAKNTAYKYSKITNCTQELNKEKAFWYELVSRVQVKTPIESINIMLNGWATY
QTIVSRLWSRTGYQQSGGAIGFRDQLQDTIGLKYTDINFMKEQILIACRHQFIEGDVEHW
WHDDINRGIRTRFSDDLLWLCYLVYEYINFTGDYTILEEEQPYVMGELLPDGVDERYDVY
LESKQKENVYTHCIRAIDRSLNFGEHGLPKIGSGDWNDGLNTVGNKQKGESIWLGFFIYN
ILEKFIPICEKRGDISRVNEYKIKKENLKKALNTAGWDGRWFRRAYMDNRRTFAEA

Enzyme Prediction     

EC	2.4.1.-

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH94	586	1432	6.2e-229	0.7693050193050193
GT84	137	351	2.4e-92	0.9953488372093023

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG3459	COG3459	2.63e-172	586	1429	1	814	Cellobiose phosphorylase [Carbohydrate transport and metabolism].
cd11756	GH94N_ChvB_NdvB_1_like	9.53e-82	879	1158	2	284	First GH94N domain of cyclic beta 1-2 glucan synthetase and similar domains. The glycoside hydrolase family 94 (previously known as glycosyltransferase family 36) includes cyclic beta 1-2 glucan synthetase (EC:2.4.1.20) or ChvB (encoded by the chromosomal chvB virulence gene). This first of two tandemly repeated GH94-N-terminal-like domains has not been characterized functionally. Some beta 1-2 glucan synthetases are annotated as NdvB (nodule development B) gene products, glycosyltransferases required for the synthesis of cyclic beta-(1,2)-glucans, which play a role in interactions between bacteria and plants.
pfam06165	Glyco_transf_36	2.58e-70	906	1142	1	247	Glycosyltransferase family 36. The glycosyltransferase family 36 includes cellobiose phosphorylase (EC:2.4.1.20), cellodextrin phosphorylase (EC:2.4.1.49), chitobiose phosphorylase (EC:2.4.1.-). Many members of this family contain two copies of this domain.
cd11753	GH94N_ChvB_NdvB_2_like	1.22e-69	343	671	1	335	Second GH94N domain of cyclic beta 1-2 glucan synthetase and similar domains. The glycoside hydrolase family 94 (previously known as glycosyltransferase family 36) includes cyclic beta 1-2 glucan synthetase (EC:2.4.1.20) or ChvB (encoded by the chromosomal chvB virulence gene). This second of two tandemly repeated GH94-N-terminal-like domains has not been characterized functionally. Some beta 1-2 glucan synthetases are annotated as NdvB (nodule development B) gene products, glycosyltransferases required for the synthesis of cyclic beta-(1,2)-glucans, which play a role in interactions between bacteria and plants.
pfam17167	Glyco_hydro_36	1.76e-69	1173	1431	1	261	Glycosyl hydrolase 36 superfamily, catalytic domain. This is the catalytic region of the superfamily of enzymes referred to as GH36. UniProtKB:Q76IQ9 is a chitobiose phosphorylase that catalyzes the reversible phosphorolysis of chitobiose into alpha-GlcNAc-1-phosphate and GlcNAc with inversion of the anomeric configuration. The full-length enzyme comprises a beta sandwich domain and an (alpha/alpha)(6) barrel domain. The alpha-helical barrel component of the domain, this family, is the catalytic region.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QSZ28298.1	0.0	3	1429	1070	2619
AEV69563.1	0.0	1	1431	1076	2677
QEK11488.1	0.0	1	1429	1041	2601
QCX34529.1	0.0	1	1429	1048	2466
SNX54535.1	0.0	5	1429	1072	2620

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
1V7V_A	4.46e-46	885	1429	3	561	Crystalstructure of Vibrio proteolyticus chitobiose phosphorylase [Vibrio proteolyticus],1V7W_A Crystal structure of Vibrio proteolyticus chitobiose phosphorylase in complex with GlcNAc [Vibrio proteolyticus],1V7X_A Crystal structure of Vibrio proteolyticus chitobiose phosphorylase in complex with GlcNAc and sulfate [Vibrio proteolyticus]
3QDE_A	6.13e-46	885	1428	3	568	ChainA, Cellobiose phosphorylase [Acetivibrio thermocellus],3QDE_B Chain B, Cellobiose phosphorylase [Acetivibrio thermocellus]
3S4C_A	1.60e-34	885	1426	3	573	Lactosephosphorylase in complex with sulfate [Cellulomonas uda],3S4D_A Lactose phosphorylase in a ternary complex with cellobiose and sulfate [Cellulomonas uda]
3RRS_A	3.70e-34	885	1426	3	573	Crystalstructure analysis of cellobiose phosphorylase from Cellulomonas uda [Cellulomonas uda],3RRS_B Crystal structure analysis of cellobiose phosphorylase from Cellulomonas uda [Cellulomonas uda],3RSY_A Cellobiose phosphorylase from Cellulomonas uda in complex with sulfate and glycerol [Cellulomonas uda],3RSY_B Cellobiose phosphorylase from Cellulomonas uda in complex with sulfate and glycerol [Cellulomonas uda],3S4A_A Cellobiose phosphorylase from Cellulomonas uda in complex with cellobiose [Cellulomonas uda],3S4A_B Cellobiose phosphorylase from Cellulomonas uda in complex with cellobiose [Cellulomonas uda],3S4B_A Cellobiose phosphorylase from Cellulomonas uda in complex with glucose [Cellulomonas uda],3S4B_B Cellobiose phosphorylase from Cellulomonas uda in complex with glucose [Cellulomonas uda]
3AFJ_A	2.81e-30	885	1426	23	593	CrystalStructure of Cellvibrio gilvus Cellobiose Phosphorylase triple mutant [Cellulomonas gilvus ATCC 13127],3AFJ_B Crystal Structure of Cellvibrio gilvus Cellobiose Phosphorylase triple mutant [Cellulomonas gilvus ATCC 13127]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P20471	6.94e-214	1	1429	1047	2601	Cyclic beta-(1,2)-glucan synthase NdvB OS=Rhizobium meliloti (strain 1021) OX=266834 GN=ndvB PE=1 SV=2
Q9F8X1	1.76e-47	885	1422	3	554	N,N'-diacetylchitobiose phosphorylase OS=Vibrio furnissii OX=29494 GN=chbP PE=1 SV=1
Q76IQ9	2.32e-45	885	1429	3	561	N,N'-diacetylchitobiose phosphorylase OS=Vibrio proteolyticus OX=671 GN=chbP PE=1 SV=1
B9K7M6	1.89e-44	885	1426	3	568	Cellobiose phosphorylase OS=Thermotoga neapolitana (strain ATCC 49049 / DSM 4359 / NBRC 107923 / NS-E) OX=309803 GN=cbpA PE=1 SV=1
Q7S0S2	1.92e-24	952	1433	83	553	Cellobionic acid phosphorylase OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) OX=367110 GN=NCU09425 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.961779	0.038037	0.000078	0.000054	0.000034	0.000046

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003974_00074.