CAZyme Information: MGYG000003975_01389

Basic Information

• Lineage: Bacteria; Firmicutes_A; Clostridia; Oscillospirales; Oscillospiraceae; UBA9475
• CAZyme ID: MGYG000003975_01389
• CAZy Family: GH125
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
324		35728.3	4.6667

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003975	2370607	MAG	United Kingdom	Europe

• Gene Location: Start: 11692; End: 12666 Strand: -

Full Sequence      

MLVTSRSTRYYVSAAYWDRDSLLWAFPAVLDADPALAREMLDYVFGRQGRNFGVHSRYID
GTVLEPGFELDELMAPVLALDRYVAATGDRDCLADGAIQAGLAGILRTLRTKRHQTAALY
ETFLQPTDDMRSHPYLTYDNVLVWRTLGALSRLYPETYGSLAGEAEAVRWAVLEHCVVQG
VSGPYYAWSTDLAGHTDIYDEPPGSLLLLPYLGFCALDDPVYQNTVRQIRTPEYPYSFAG
CAFAEIGCAHAPHPWMLSVANSLLSGQAERALDILRRAEMDNGIVCESIDEHTGRSATGE
AFATCAGFVCHALRYALGGAAYEN

Enzyme Prediction     

No EC number prediction in MGYG000003975_01389.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH125	119	311	3.8e-19	0.5124378109452736

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam06824	Glyco_hydro_125	2.84e-19	54	290	108	392	Metal-independent alpha-mannosidase (GH125). This family, which contains bacterial and fungal glycoside hydrolases, is also known as GH125. They function as metal-independent alpha-mannosidases, with specificity for alpha-1,6-linked non-reducing terminal mannose residues. Structurally this family is part of the 6 hairpin glycosidase superfamily.
COG3538	COG3538	1.44e-18	15	303	60	409	Meiotically up-regulated gene 157 (Mug157) protein (function unknown) [Function unknown].
COG3387	SGA1	0.002	69	303	351	593	Glucoamylase (glucan-1,4-alpha-glucosidase), GH15 family [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QQR05501.1	1.36e-210	1	324	276	599
ANU41635.1	1.36e-210	1	324	276	599
QIA31705.1	2.23e-209	1	324	276	599
QEY34932.1	4.05e-145	1	314	276	588
QKN24824.1	4.15e-141	1	314	271	583

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3QPF_A	7.40e-12	125	293	215	401	Analysisof a New Family of Widely Distributed Metal-independent alpha-Mannosidases Provides Unique Insight into the Processing of N-linked Glycans, Streptococcus pneumoniae SP_2144 apo-structure [Streptococcus pneumoniae],3QPF_B Analysis of a New Family of Widely Distributed Metal-independent alpha-Mannosidases Provides Unique Insight into the Processing of N-linked Glycans, Streptococcus pneumoniae SP_2144 apo-structure [Streptococcus pneumoniae],3QRY_A Analysis of a new family of widely distributed metal-independent alpha mannosidases provides unique insight into the processing of N-linked glycans, Streptococcus pneumoniae SP_2144 1-deoxymannojirimycin complex [Streptococcus pneumoniae],3QRY_B Analysis of a new family of widely distributed metal-independent alpha mannosidases provides unique insight into the processing of N-linked glycans, Streptococcus pneumoniae SP_2144 1-deoxymannojirimycin complex [Streptococcus pneumoniae],3QSP_A Analysis of a new family of widely distributed metal-independent alpha mannosidases provides unique insight into the processing of N-linked glycans, Streptococcus pneumoniae SP_2144 non-productive substrate complex with alpha-1,6-mannobiose [Streptococcus pneumoniae],3QSP_B Analysis of a new family of widely distributed metal-independent alpha mannosidases provides unique insight into the processing of N-linked glycans, Streptococcus pneumoniae SP_2144 non-productive substrate complex with alpha-1,6-mannobiose [Streptococcus pneumoniae]
2P0V_A	1.11e-11	15	303	105	455	Crystalstructure of BT3781 protein from Bacteroides thetaiotaomicron, Northeast Structural Genomics Target BtR58 [Bacteroides thetaiotaomicron VPI-5482],2P0V_B Crystal structure of BT3781 protein from Bacteroides thetaiotaomicron, Northeast Structural Genomics Target BtR58 [Bacteroides thetaiotaomicron VPI-5482]
3P2C_A	1.46e-10	15	267	87	397	Crystalstructure of an exo-alpha-1,6-mannosidase (bacova_03347) from bacteroides ovatus at 1.60 a resolution [Bacteroides ovatus ATCC 8483],3P2C_B Crystal structure of an exo-alpha-1,6-mannosidase (bacova_03347) from bacteroides ovatus at 1.60 a resolution [Bacteroides ovatus ATCC 8483]
3ON6_A	3.49e-10	65	303	154	435	Crystalstructure of an exo-alpha-1,6-mannosidase (bacova_03626) from bacteroides ovatus at 1.70 a resolution [Bacteroides ovatus ATCC 8483],3ON6_B Crystal structure of an exo-alpha-1,6-mannosidase (bacova_03626) from bacteroides ovatus at 1.70 a resolution [Bacteroides ovatus ATCC 8483]
3QT3_A	1.87e-09	63	263	127	363	Analysisof a New Family of Widely Distributed Metal-independent alpha-Mannosidases Provides Unique Insight into the Processing of N-linked Glycans, Clostridium perfringens CPE0426 apo-structure [Clostridium perfringens],3QT9_A Analysis of a new family of widely distributed metal-independent alpha mannosidases provides unique insight into the processing of N-linked glycans, Clostridium perfringens CPE0426 complexed with alpha-1,6-linked 1-thio-alpha-mannobiose [Clostridium perfringens]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q10449	2.04e-09	117	298	283	478	Meiotically up-regulated gene 157 protein OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=mug157 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000037	0.000002	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003975_01389.