CAZyme Information: MGYG000003985_00865

Basic Information

• Species: CAG-873 sp002493945
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Muribaculaceae; CAG-873; CAG-873 sp002493945
• CAZyme ID: MGYG000003985_00865
• CAZy Family: GH27
• CAZyme Description: Isomalto-dextranase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
389		43580.81	5.3978

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003985	2303173	MAG	United Kingdom	Europe

• Gene Location: Start: 4570; End: 5739 Strand: -

Full Sequence      

MARDLKPHGYDMVCTDGFIPMLAKDASGYMTHYGSTALKDLVAKAEARGLKVGVYDNPLW
IHGDESTLIEGTDYTFANLPYRGVEEVTNPDATGDRWFKWAMADHPGAREYIDGFFKHYS
DLGIKYIRMDFLSWYEDGKDRNMGTVGYGYGRASYGRALSYIAESAKKYGVFTSLVMPHM
YNDAELEARYGNMVRIVADTATGGWWHYSSADRGRTYANWPNCMNMFDGFIYWSHIAGKD
KVILDGDFIRLNTFETEAEKQSVVSLQLMAGGPVTVSDQYHNIGSNLQYYTNDELLALNA
DRFVGHPLSETLSDANSQIWYGQMSDGSYVVGMFNREDAGKSVTLSLSDLGLTGSWNVRD
LWQHKDEGSTSTLSAQIPARGCKIVKLTK

Enzyme Prediction     

No EC number prediction in MGYG000003985_00865.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH27	111	367	1.2e-32	0.9388646288209607

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam17801	Melibiase_C	6.02e-19	314	387	1	74	Alpha galactosidase C-terminal beta sandwich domain. This domain is found at the C-terminus of alpha galactosidase enzymes.
PLN02229	PLN02229	2.21e-09	256	388	279	418	alpha-galactosidase
PLN02808	PLN02808	6.14e-09	256	388	249	384	alpha-galactosidase
PLN02692	PLN02692	3.95e-05	292	384	310	405	alpha-galactosidase
cd14792	GH27	5.55e-05	5	301	32	271	glycosyl hydrolase family 27 (GH27). GH27 enzymes occur in eukaryotes, prokaryotes, and archaea with a wide range of hydrolytic activities, including alpha-glucosidase (glucoamylase and sucrase-isomaltase), alpha-N-acetylgalactosaminidase, and 3-alpha-isomalto-dextranase. All GH27 enzymes cleave a terminal carbohydrate moiety from a substrate that varies considerably in size, depending on the enzyme, and may be either a starch or a glycoprotein. GH27 members are retaining enzymes that cleave their substrates via an acid/base-catalyzed, double-displacement mechanism involving a covalent glycosyl-enzyme intermediate. Two aspartic acid residues have been identified as the catalytic nucleophile and the acid/base, respectively.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QNT67171.1	4.00e-200	1	387	86	473
QUT44530.1	6.04e-175	1	389	95	492
QUT79686.1	6.04e-175	1	389	95	492
QUU07210.1	6.04e-175	1	389	95	492
QRM98947.1	6.04e-175	1	389	95	492

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5AWO_A	3.21e-86	1	388	66	466	Arthrobacterglobiformis T6 isomalto-dextranse [Arthrobacter globiformis],5AWP_A Arthrobacter globiformis T6 isomalto-dextranase complexed with isomaltose [Arthrobacter globiformis],5AWQ_A Arthrobacter globiformis T6 isomalto-dextranse complexed with panose [Arthrobacter globiformis]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q44052	4.69e-86	1	388	92	492	Isomalto-dextranase OS=Arthrobacter globiformis OX=1665 GN=imd PE=1 SV=1
P14749	6.62e-09	256	388	273	408	Alpha-galactosidase OS=Cyamopsis tetragonoloba OX=3832 PE=1 SV=1
Q8VXZ7	7.04e-09	245	388	277	428	Alpha-galactosidase 3 OS=Arabidopsis thaliana OX=3702 GN=AGAL3 PE=1 SV=1
Q5AX28	6.39e-07	244	389	253	401	Alpha-galactosidase D OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=aglD PE=1 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000072	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003985_00865.