CAZyme Information: MGYG000003985_01595

Basic Information

• Species: CAG-873 sp002493945
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Muribaculaceae; CAG-873; CAG-873 sp002493945
• CAZyme ID: MGYG000003985_01595
• CAZy Family: GH2
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
254		29559.08	4.9342

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003985	2303173	MAG	United Kingdom	Europe

• Gene Location: Start: 9; End: 773 Strand: +

Full Sequence      

MIYDVDKTLDWGYNMIRKHIKVEPAAWYTYCDRKGIIVWQDMPSGDKSPEWQGRNYFDGE
ELVRTPESEATYRKEWKEIIDALYNYPCIAVWVPFNEAWGQFKTKEIADWTKSYDPSRLV
NPASGGNHYPCGDMVDAHSYPSPPVTHVYDAKRANVLGEYGGIGMVAEGHIWAPDRNWGY
IQYKTPAEVTDAYIGYADYLDRLADDWFVGAVYTQTTDVEIEVNGLMTYDRKVIKIDEDR
IRERNRRLINNHSK

Enzyme Prediction     

No EC number prediction in MGYG000003985_01595.

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam02836	Glyco_hydro_2_C	1.40e-06	27	120	64	158	Glycosyl hydrolases family 2, TIM barrel domain. This family contains beta-galactosidase, beta-mannosidase and beta-glucuronidase activities.
COG3250	LacZ	5.24e-06	1	173	323	498	Beta-galactosidase/beta-glucuronidase [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AHF13310.1	3.60e-185	1	254	352	605
QUT89074.1	1.62e-135	1	254	353	605
QMI79934.1	2.29e-135	1	254	353	605
BBK86513.1	2.86e-135	1	254	303	555
ALJ59901.1	6.50e-135	1	254	353	605

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
7SF2_A	2.74e-131	1	254	336	588	ChainA, Glycosyl hydrolase family 2, sugar binding domain protein [Bacteroides cellulosilyticus DSM 14838],7SF2_B Chain B, Glycosyl hydrolase family 2, sugar binding domain protein [Bacteroides cellulosilyticus DSM 14838],7SF2_C Chain C, Glycosyl hydrolase family 2, sugar binding domain protein [Bacteroides cellulosilyticus DSM 14838],7SF2_D Chain D, Glycosyl hydrolase family 2, sugar binding domain protein [Bacteroides cellulosilyticus DSM 14838],7SF2_E Chain E, Glycosyl hydrolase family 2, sugar binding domain protein [Bacteroides cellulosilyticus DSM 14838],7SF2_F Chain F, Glycosyl hydrolase family 2, sugar binding domain protein [Bacteroides cellulosilyticus DSM 14838]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
A5F5U6	5.29e-06	4	231	373	609	Beta-galactosidase OS=Vibrio cholerae serotype O1 (strain ATCC 39541 / Classical Ogawa 395 / O395) OX=345073 GN=lacZ PE=3 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000056	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003985_01595.