CAZyme Information: MGYG000003986_00225

Basic Information

• Species: CAG-485 sp900761855
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Muribaculaceae; CAG-485; CAG-485 sp900761855
• CAZyme ID: MGYG000003986_00225
• CAZy Family: GH73
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
294		33243.4	7.4731

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003986	2429324	MAG	United Kingdom	Europe

• Gene Location: Start: 56958; End: 57842 Strand: -

Full Sequence      

MKKLFVAAIISLLPATVLADTADDRYTSYINRYSKMAVEQQQAYGIPASITLAQGLLESA
AGHSTLASKGNNHFGIKCHKEWQGDFMLRDDDAPDECFRVYSNAAESFRDHSLFLSRPRY
KSLYDNDITDYAAWARGLSKCGYATDPNYAARLIAIIERYALYTYDTEAGRHAEETTDFI
RQQLLKTHPVRRSRGLHYVIANPGDTYSALAREFHIDKKKLLRYNDAQADNIREWQEVYL
EPKLDCGPDGVATATIGEDETIHSIAQRYGIQLKALQALNPGAKDRPGQRLRLR

Enzyme Prediction     

No EC number prediction in MGYG000003986_00225.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH73	35	162	8.6e-35	0.9765625

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG1705	FlgJ	1.18e-37	15	167	32	189	Flagellum-specific peptidoglycan hydrolase FlgJ [Cell wall/membrane/envelope biogenesis, Cell motility].
NF038016	sporang_Gsm	2.14e-33	14	166	152	312	sporangiospore maturation cell wall hydrolase GsmA. The peptidoglycan-hydrolyzing enzyme GsmA occurs in some sporangia-forming members of the Actinobacteria, such as Actinoplanes missouriensis, and is required for proper separation of spores. GsmA proteins have one or two SH3 domains N-terminal to the hydrolase domain.
pfam01832	Glucosaminidase	7.25e-26	35	162	2	91	Mannosyl-glycoprotein endo-beta-N-acetylglucosaminidase. This family includes Mannosyl-glycoprotein endo-beta-N-acetylglucosaminidase EC:3.2.1.96. As well as the flageller protein J that has been shown to hydrolyze peptidoglycan.
smart00047	LYZ2	2.60e-25	28	166	10	147	Lysozyme subfamily 2. Eubacterial enzymes distantly related to eukaryotic lysozymes.
TIGR02541	flagell_FlgJ	2.13e-21	19	161	141	294	flagellar rod assembly protein/muramidase FlgJ. The N-terminal region of this protein acts directly in flagellar rod assembly. The C-terminal region is a flagellum-specific muramidase (peptidoglycan hydrolase) required for formation of the outer membrane L ring.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AVM56573.1	9.00e-80	6	294	10	307
QCQ36508.1	1.40e-79	2	294	4	299
QLK82793.1	1.40e-79	2	294	4	299
AUI45961.1	1.40e-79	2	294	4	299
QRM70429.1	1.40e-79	2	294	4	299

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3VWO_A	5.72e-12	28	162	3	148	Crystalstructure of peptidoglycan hydrolase mutant from Sphingomonas sp. A1 [Sphingomonas sp. A1]
2ZYC_A	6.81e-12	28	162	4	149	ChainA, Peptidoglycan hydrolase FlgJ [Sphingomonas sp. A1]
3K3T_A	4.53e-11	28	162	4	149	E185Amutant of peptidoglycan hydrolase from Sphingomonas sp. A1 [Sphingomonas sp. A1]
5T1Q_A	4.63e-11	20	168	56	214	ChainA, N-acetylmuramoyl-L-alanine amidase domain-containing protein SAOUHSC_02979 [Staphylococcus aureus subsp. aureus NCTC 8325],5T1Q_B Chain B, N-acetylmuramoyl-L-alanine amidase domain-containing protein SAOUHSC_02979 [Staphylococcus aureus subsp. aureus NCTC 8325],5T1Q_C Chain C, N-acetylmuramoyl-L-alanine amidase domain-containing protein SAOUHSC_02979 [Staphylococcus aureus subsp. aureus NCTC 8325],5T1Q_D Chain D, N-acetylmuramoyl-L-alanine amidase domain-containing protein SAOUHSC_02979 [Staphylococcus aureus subsp. aureus NCTC 8325]
5DN5_A	1.33e-10	34	159	14	147	Structureof a C-terminally truncated glycoside hydrolase domain from Salmonella typhimurium FlgJ [Salmonella enterica subsp. enterica serovar Typhimurium str. LT2],5DN5_B Structure of a C-terminally truncated glycoside hydrolase domain from Salmonella typhimurium FlgJ [Salmonella enterica subsp. enterica serovar Typhimurium str. LT2],5DN5_C Structure of a C-terminally truncated glycoside hydrolase domain from Salmonella typhimurium FlgJ [Salmonella enterica subsp. enterica serovar Typhimurium str. LT2]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
O32083	2.40e-15	4	166	25	198	Exo-glucosaminidase LytG OS=Bacillus subtilis (strain 168) OX=224308 GN=lytG PE=1 SV=1
Q9X9J3	2.08e-14	24	159	158	304	Peptidoglycan hydrolase FlgJ OS=Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633) OX=223926 GN=flgJ PE=3 SV=1
P37710	2.88e-11	27	280	181	457	Autolysin OS=Enterococcus faecalis (strain ATCC 700802 / V583) OX=226185 GN=EF_0799 PE=1 SV=2
Q2G222	3.77e-10	20	168	316	474	N-acetylmuramoyl-L-alanine amidase domain-containing protein SAOUHSC_02979 OS=Staphylococcus aureus (strain NCTC 8325 / PS 47) OX=93061 GN=SAOUHSC_02979 PE=1 SV=1
P15931	4.11e-09	34	159	163	296	Peptidoglycan hydrolase FlgJ OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) OX=99287 GN=flgJ PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000221	0.999076	0.000182	0.000171	0.000164	0.000144

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003986_00225.