CAZyme Information: MGYG000003986_00322

Basic Information

• Species: CAG-485 sp900761855
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Muribaculaceae; CAG-485; CAG-485 sp900761855
• CAZyme ID: MGYG000003986_00322
• CAZy Family: GH53
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
417		47157.9	6.5839

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003986	2429324	MAG	United Kingdom	Europe

• Gene Location: Start: 6140; End: 7393 Strand: +

Full Sequence      

MHTRLILLIAVLASIFSSAMAKDRYVGGDISLLPEYEKAGAKYYDHDGKPIARLLPWCRE
QGMNAMRVRLFVNPKDYKGSDTDPNACQDLDYIIPLCNQIKQAGLALMLDFHYSDTWADP
AKQWTPAAWGNLTDEQLYQKIYDYTRASLDTLKSHGITPDFIQPGNEISFGMLWGTVGTP
EAQLKKTFMGSEANWKRLGNLLNQAIKACREVCPAARIVIHTERVAQPDVLANFYDQMKK
LGVDYDIIGLSYYPYFHGKMPVLTAALTRLTTRFPEKEIMIVETGYPYAWEVPGTDQKVD
YPYTEEGQNTFARALVNELLKFDNVTGLFWWWMEYNAKDTDLAGWYNAPLFDSRTGRVTL
AFKTLCSFATGHGSIDGILPDAEAVSSRPWHDLLGRPVKTPSHGTIYISPDGKKLKY

Enzyme Prediction     

No EC number prediction in MGYG000003986_00322.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH53	26	354	7.1e-91	0.9649122807017544

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam07745	Glyco_hydro_53	9.98e-88	25	365	1	333	Glycosyl hydrolase family 53. This domain belongs to family 53 of the glycosyl hydrolase classification. These enzymes are enzymes are endo-1,4- beta-galactanases (EC:3.2.1.89). The structure of this domain is known and has a TIM barrel fold.
COG3867	GanB	1.37e-77	18	352	33	379	Arabinogalactan endo-1,4-beta-galactosidase [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
VEH14955.1	8.02e-133	24	369	47	398
ADE83762.1	1.18e-131	10	408	10	407
QVJ80245.1	1.59e-112	6	408	6	414
QUT66820.1	1.32e-94	21	368	21	363
AGB28452.1	4.63e-88	23	368	21	367

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
7OSK_A	1.76e-53	27	352	53	379	ChainA, Arabinogalactan endo-1,4-beta-galactosidase [Ignisphaera aggregans DSM 17230],7OSK_B Chain B, Arabinogalactan endo-1,4-beta-galactosidase [Ignisphaera aggregans DSM 17230]
1R8L_A	5.71e-43	18	331	18	320	Thestructure of endo-beta-1,4-galactanase from Bacillus licheniformis [Bacillus licheniformis],1R8L_B The structure of endo-beta-1,4-galactanase from Bacillus licheniformis [Bacillus licheniformis],1UR0_A The structure of endo-beta-1,4-galactanase from Bacillus licheniformis in complex with two oligosaccharide products. [Bacillus licheniformis],1UR0_B The structure of endo-beta-1,4-galactanase from Bacillus licheniformis in complex with two oligosaccharide products. [Bacillus licheniformis],1UR4_A The structure of endo-beta-1,4-galactanase from Bacillus licheniformis in complex with two oligosaccharide products. [Bacillus licheniformis],1UR4_B The structure of endo-beta-1,4-galactanase from Bacillus licheniformis in complex with two oligosaccharide products. [Bacillus licheniformis],2CCR_A Structure of Beta-1,4-Galactanase [Bacillus licheniformis],2CCR_B Structure of Beta-1,4-Galactanase [Bacillus licheniformis],2J74_A Structure of Beta-1,4-Galactanase [Bacillus licheniformis],2J74_B Structure of Beta-1,4-Galactanase [Bacillus licheniformis]
2GFT_A	4.15e-42	18	331	18	320	ChainA, Glycosyl Hydrolase Family 53 [Bacillus licheniformis],2GFT_B Chain B, Glycosyl Hydrolase Family 53 [Bacillus licheniformis]
1HJS_A	5.20e-41	25	331	4	296	Structureof two fungal beta-1,4-galactanases: searching for the basis for temperature and pH optimum. [Thermothelomyces thermophilus],1HJS_B Structure of two fungal beta-1,4-galactanases: searching for the basis for temperature and pH optimum. [Thermothelomyces thermophilus],1HJS_C Structure of two fungal beta-1,4-galactanases: searching for the basis for temperature and pH optimum. [Thermothelomyces thermophilus],1HJS_D Structure of two fungal beta-1,4-galactanases: searching for the basis for temperature and pH optimum. [Thermothelomyces thermophilus],1HJU_A Structure of two fungal beta-1,4-galactanases: searching for the basis for temperature and pH optimum. [Thermothelomyces thermophilus],1HJU_B Structure of two fungal beta-1,4-galactanases: searching for the basis for temperature and pH optimum. [Thermothelomyces thermophilus],1HJU_C Structure of two fungal beta-1,4-galactanases: searching for the basis for temperature and pH optimum. [Thermothelomyces thermophilus],1HJU_D Structure of two fungal beta-1,4-galactanases: searching for the basis for temperature and pH optimum. [Thermothelomyces thermophilus]
1HJQ_A	1.96e-40	24	331	3	296	Structureof two fungal beta-1,4-galactanases: searching for the basis for temperature and pH optimum. [Humicola insolens]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P48843	7.00e-53	26	365	8	346	Uncharacterized protein in bgaB 5'region (Fragment) OS=Niallia circulans OX=1397 PE=3 SV=1
A1D3T4	5.43e-47	17	343	17	334	Probable arabinogalactan endo-beta-1,4-galactanase A OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / CBS 544.65 / FGSC A1164 / JCM 1740 / NRRL 181 / WB 181) OX=331117 GN=galA PE=3 SV=1
P48841	9.35e-45	12	353	13	352	Arabinogalactan endo-beta-1,4-galactanase OS=Cellvibrio japonicus (strain Ueda107) OX=498211 GN=ganB PE=1 SV=1
B0XPR3	6.13e-44	17	343	17	334	Probable arabinogalactan endo-beta-1,4-galactanase A OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) OX=451804 GN=galA PE=3 SV=2
Q4WJ80	1.67e-43	17	343	17	334	Probable arabinogalactan endo-beta-1,4-galactanase A OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) OX=330879 GN=galA PE=3 SV=2

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000265	0.999033	0.000186	0.000169	0.000157	0.000139

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003986_00322.