CAZyme Information: MGYG000003987_00861

Basic Information

• Species: UBA1691 sp900544375
• Lineage: Bacteria; Firmicutes_A; Clostridia; Oscillospirales; Acutalibacteraceae; UBA1691; UBA1691 sp900544375
• CAZyme ID: MGYG000003987_00861
• CAZy Family: GT2
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
297		33683.04	8.1714

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003987	2710592	MAG	United Kingdom	Europe

• Gene Location: Start: 21990; End: 22883 Strand: -

Full Sequence      

MKFKFILSICFGGLWLAVSLFFAIGWAQEVSYIFPSVYVWWVIIGIALLPGFLMSAMFFS
NLLHWKLKRYPDIAEDTTILMCAHNEEKNIARSIQAILNQQYAGRIRLIVVDNGSNDHTK
QQIMNMQTAALTNCSIEYVYCDQPGKAHALNYGLAMIHTPHFITVDADTYLQKQAVQRIM
NHIVSCGSVCVAGNLFVQNAKASLAARMQNYDYLLSIAAIKRFQGSYQSTLVAQGAFSAY
QTEAVQQSKLGEEHSPLLVRKSEFPFDFNVFFCSMDNLNQHIHNHPFVVQRKIFPFA

Enzyme Prediction     

No EC number prediction in MGYG000003987_00861.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT2	78	246	2e-23	0.9764705882352941

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd06423	CESA_like	2.40e-38	79	247	1	168	CESA_like is the cellulose synthase superfamily. The cellulose synthase (CESA) superfamily includes a wide variety of glycosyltransferase family 2 enzymes that share the common characteristic of catalyzing the elongation of polysaccharide chains. The members include cellulose synthase catalytic subunit, chitin synthase, glucan biosynthesis protein and other families of CESA-like proteins. Cellulose synthase catalyzes the polymerization reaction of cellulose, an aggregate of unbranched polymers of beta-1,4-linked glucose residues in plants, most algae, some bacteria and fungi, and even some animals. In bacteria, algae and lower eukaryotes, there is a second unrelated type of cellulose synthase (Type II), which produces acylated cellulose, a derivative of cellulose. Chitin synthase catalyzes the incorporation of GlcNAc from substrate UDP-GlcNAc into chitin, which is a linear homopolymer of beta-(1,4)-linked GlcNAc residues and Glucan Biosynthesis protein catalyzes the elongation of beta-1,2 polyglucose chains of Glucan.
pfam00535	Glycos_transf_2	8.76e-21	78	245	1	164	Glycosyl transferase family 2. Diverse family, transferring sugar from UDP-glucose, UDP-N-acetyl- galactosamine, GDP-mannose or CDP-abequose, to a range of substrates including cellulose, dolichol phosphate and teichoic acids.
cd00761	Glyco_tranf_GTA_type	5.40e-19	79	194	1	114	Glycosyltransferase family A (GT-A) includes diverse families of glycosyl transferases with a common GT-A type structural fold. Glycosyltransferases (GTs) are enzymes that synthesize oligosaccharides, polysaccharides, and glycoconjugates by transferring the sugar moiety from an activated nucleotide-sugar donor to an acceptor molecule, which may be a growing oligosaccharide, a lipid, or a protein. Based on the stereochemistry of the donor and acceptor molecules, GTs are classified as either retaining or inverting enzymes. To date, all GT structures adopt one of two possible folds, termed GT-A fold and GT-B fold. This hierarchy includes diverse families of glycosyl transferases with a common GT-A type structural fold, which has two tightly associated beta/alpha/beta domains that tend to form a continuous central sheet of at least eight beta-strands. The majority of the proteins in this superfamily are Glycosyltransferase family 2 (GT-2) proteins. But it also includes families GT-43, GT-6, GT-8, GT13 and GT-7; which are evolutionarily related to GT-2 and share structure similarities.
COG1215	BcsA	3.83e-17	29	247	13	228	Glycosyltransferase, catalytic subunit of cellulose synthase and poly-beta-1,6-N-acetylglucosamine synthase [Cell motility].
PRK11204	PRK11204	2.87e-15	66	247	49	223	N-glycosyltransferase; Provisional

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AYK56005.1	6.49e-140	1	253	73	330
BBK23272.1	1.07e-95	1	246	1	246
BBK63014.1	1.07e-95	1	246	1	246
API90022.1	1.22e-48	4	247	17	261
CUU50147.1	2.81e-48	2	247	23	269

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P75905	5.22e-12	66	247	70	244	Poly-beta-1,6-N-acetyl-D-glucosamine synthase OS=Escherichia coli (strain K12) OX=83333 GN=pgaC PE=1 SV=1
Q8XAR5	5.22e-12	66	247	70	244	Poly-beta-1,6-N-acetyl-D-glucosamine synthase OS=Escherichia coli O157:H7 OX=83334 GN=pgaC PE=3 SV=1
Q07755	1.40e-06	79	267	52	240	N-acetylglucosaminyltransferase OS=Azorhizobium caulinodans (strain ATCC 43989 / DSM 5975 / JCM 20966 / LMG 6465 / NBRC 14845 / NCIMB 13405 / ORS 571) OX=438753 GN=nodC PE=3 SV=2
P0C0H0	2.59e-06	61	245	51	237	Hyaluronan synthase OS=Streptococcus pyogenes OX=1314 GN=hasA PE=3 SV=1
P0C0H1	2.59e-06	61	245	51	237	Hyaluronan synthase OS=Streptococcus pyogenes serotype M1 OX=301447 GN=hasA PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000021	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

start	end
5	27
37	59