CAZyme Information: MGYG000003987_01390

Basic Information

• Species: UBA1691 sp900544375
• Lineage: Bacteria; Firmicutes_A; Clostridia; Oscillospirales; Acutalibacteraceae; UBA1691; UBA1691 sp900544375
• CAZyme ID: MGYG000003987_01390
• CAZy Family: GH29
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
350	MGYG000003987_56|CGC1	41423.91	6.6509

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003987	2710592	MAG	United Kingdom	Europe

• Gene Location: Start: 6866; End: 7918 Strand: -

Full Sequence      

MFFQKKMAPYPSRTYPIMQQPSLQPNEGQLAQMQRRFGMFLHFGVNTFNNTEWSDGTLPV
ESYCPSAIDADSWVRTAYEAGMNYVVLITKHHDGFCLWDTHTTTYSVNYSPNQTDVVRAV
ADACRKYGLRLGLYYSLWDRHELCYGDDEAYVQYMEKHLTELLDGRYGEVVELWFDGAWD
KPCRAWQLDRLYNHVKQMQPMCQIGVNHTVGKYSEKKGGPQKRYEPRNYRDRDPLRMFPS
DFRLWDPHMCREDDPKIYTFNKKEYYLPFEQTICSRKEFSWFYSDTYADKPLMDAQEIIR
NYRILEKTNNMMVINLPPDQNGKLVQGDVDNLMRVAGELGIRREIERVHG

Enzyme Prediction     

No EC number prediction in MGYG000003987_01390.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH29	33	336	7.9e-64	0.8323699421965318

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
smart00812	Alpha_L_fucos	1.59e-39	18	344	2	335	Alpha-L-fucosidase. O-Glycosyl hydrolases (EC 3.2.1.-) are a widespread group of enzymes that hydrolyse the glycosidic bond between two or more carbohydrates, or between a carbohydrate and a non-carbohydrate moiety. A classification system for glycosyl hydrolases, based on sequence similarity, has led to the definition of 85 different families. This classification is available on the CAZy (CArbohydrate-Active EnZymes) web site. Because the fold of proteins is better conserved than their sequences, some of the families can be grouped in 'clans'. Family 29 encompasses alpha-L-fucosidases, which is a lysosomal enzyme responsible for hydrolyzing the alpha-1,6-linked fucose joined to the reducing-end N-acetylglucosamine of the carbohydrate moieties of glycoproteins. Deficiency of alpha-L-fucosidase results in the lysosomal storage disease fucosidosis.
COG3669	AfuC	1.52e-35	25	344	11	317	Alpha-L-fucosidase [Carbohydrate transport and metabolism].
pfam01120	Alpha_L_fucos	4.40e-35	36	221	26	247	Alpha-L-fucosidase.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QBN20382.1	2.38e-107	26	342	27	336
ATP59154.1	2.38e-105	21	335	29	343
QOD60739.1	2.49e-105	29	342	35	341
QIL40371.1	3.19e-102	20	341	33	351
QRO24265.1	6.68e-102	21	341	30	349

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4ZRX_A	1.30e-46	23	336	30	349	Crystalstructure of a putative alpha-L-fucosidase (BACOVA_04357) from Bacteroides ovatus ATCC 8483 at 1.59 A resolution [Bacteroides ovatus ATCC 8483]
3UES_A	9.59e-41	22	344	16	352	Crystalstructure of alpha-1,3/4-fucosidase from Bifidobacterium longum subsp. infantis complexed with deoxyfuconojirimycin [Bifidobacterium longum subsp. infantis ATCC 15697 = JCM 1222 = DSM 20088],3UES_B Crystal structure of alpha-1,3/4-fucosidase from Bifidobacterium longum subsp. infantis complexed with deoxyfuconojirimycin [Bifidobacterium longum subsp. infantis ATCC 15697 = JCM 1222 = DSM 20088]
3UET_A	2.54e-39	22	344	16	352	Crystalstructure of alpha-1,3/4-fucosidase from Bifidobacterium longum subsp. infantis D172A/E217A mutant complexed with lacto-N-fucopentaose II [Bifidobacterium longum subsp. infantis ATCC 15697 = JCM 1222 = DSM 20088],3UET_B Crystal structure of alpha-1,3/4-fucosidase from Bifidobacterium longum subsp. infantis D172A/E217A mutant complexed with lacto-N-fucopentaose II [Bifidobacterium longum subsp. infantis ATCC 15697 = JCM 1222 = DSM 20088]
3MO4_A	4.92e-38	22	344	18	354	Thecrystal structure of an alpha-(1-3,4)-fucosidase from Bifidobacterium longum subsp. infantis ATCC 15697 [Bifidobacterium longum subsp. infantis ATCC 15697 = JCM 1222 = DSM 20088],3MO4_B The crystal structure of an alpha-(1-3,4)-fucosidase from Bifidobacterium longum subsp. infantis ATCC 15697 [Bifidobacterium longum subsp. infantis ATCC 15697 = JCM 1222 = DSM 20088]
5K9H_A	1.59e-36	25	328	39	341	Crystalstructure of a glycoside hydrolase 29 family member from an unknown rumen bacterium [unidentified]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q8GW72	1.08e-38	7	329	27	330	Alpha-L-fucosidase 1 OS=Arabidopsis thaliana OX=3702 GN=FUC1 PE=1 SV=2
Q7XUR3	8.72e-38	16	332	35	334	Putative alpha-L-fucosidase 1 OS=Oryza sativa subsp. japonica OX=39947 GN=Os04g0560400 PE=3 SV=2
Q9VTJ4	1.78e-13	24	193	35	249	Putative alpha-L-fucosidase OS=Drosophila melanogaster OX=7227 GN=Fuca PE=2 SV=2
P10901	1.34e-09	36	344	41	358	Alpha-L-fucosidase OS=Dictyostelium discoideum OX=44689 GN=alfA PE=3 SV=1
Q2KIM0	2.42e-09	34	193	58	254	Tissue alpha-L-fucosidase OS=Bos taurus OX=9913 GN=FUCA1 PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000056	0.000001	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003987_01390.