CAZyme Information: MGYG000003987_01981

Basic Information

• Species: UBA1691 sp900544375
• Lineage: Bacteria; Firmicutes_A; Clostridia; Oscillospirales; Acutalibacteraceae; UBA1691; UBA1691 sp900544375
• CAZyme ID: MGYG000003987_01981
• CAZy Family: CBM35
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
697		76616.74	5.9214

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003987	2710592	MAG	United Kingdom	Europe

• Gene Location: Start: 1968; End: 4061 Strand: -

Full Sequence      

MFFQFCGTMVQKCIALLMTLLMNLGAAVSAVIQPISLPTLAQSASTYTVGNLTVQLDLGD
GSYTVAHKGITIFRKAYAAVMLDSLLSSSDYEAHSVNTAPLHDAAGNGLKITVLHTGPAL
PNLRQDFLLYEGRDYLLTQATLCAEEGGTVKTNYISPLSISQKGNVQAAAPRWSRFLEVP
FDNDAWVTFETKSLFQKGQSHEAAAFFEPDDGAGLILGSVTHDTWKTGISFEGSWGNIRS
LTAYSGANTALTRDQSPHGAVSGREVPSALLFIGIFDHWKTGMNTFAQANTAITPKKETS
LKSIPIGWNSWGSVQTDLTLQTAIGISDYISDYLQPAWQTEGETVFVNLDSYWDNLTDDE
LKTFVTHCRKNGQEAGIYWAPFVSWLGANALGSTYVEGTHAPVLYKDVILKKADGTPYGN
DIDGCFPLDVTHPAVRARMRWMIGRFLEAGFTYIKFDFMGHGALEGQHFDPAVQTGMQAY
NHGMAYLNELIGGRMFINLSIAPIFPYQYAHGRRIACDAFYAMKDTKYTLNALTYGFWEQ
ELYAYPDPDHLVIWGKDGKASENEARSRLTLGAIAGTSFLTGDNFIAPAGNAGQANERFL
TLLTNADILRVAKFGRAFTPVIEKHCPQSASIYRLEQDGRLYFAVFNFSVLPQYQEIPVN
GVFHSKELWSGKQASGKETLGVWLAGRNAALYEVELL

Enzyme Prediction     

No EC number prediction in MGYG000003987_01981.

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd14791	GH36	7.70e-17	305	583	3	278	glycosyl hydrolase family 36 (GH36). GH36 enzymes occur in prokaryotes, eukaryotes, and archaea with a wide range of hydrolytic activities, including alpha-galactosidase, alpha-N-acetylgalactosaminidase, stachyose synthase, and raffinose synthase. All GH36 enzymes cleave a terminal carbohydrate moiety from a substrate that varies considerably in size, depending on the enzyme, and may be either a starch or a glycoprotein. GH36 members are retaining enzymes that cleave their substrates via an acid/base-catalyzed, double-displacement mechanism involving a covalent glycosyl-enzyme intermediate. Two aspartic acid residues have been identified as the catalytic nucleophile and the acid/base, respectively.
cd14792	GH27	7.15e-07	305	611	2	268	glycosyl hydrolase family 27 (GH27). GH27 enzymes occur in eukaryotes, prokaryotes, and archaea with a wide range of hydrolytic activities, including alpha-glucosidase (glucoamylase and sucrase-isomaltase), alpha-N-acetylgalactosaminidase, and 3-alpha-isomalto-dextranase. All GH27 enzymes cleave a terminal carbohydrate moiety from a substrate that varies considerably in size, depending on the enzyme, and may be either a starch or a glycoprotein. GH27 members are retaining enzymes that cleave their substrates via an acid/base-catalyzed, double-displacement mechanism involving a covalent glycosyl-enzyme intermediate. Two aspartic acid residues have been identified as the catalytic nucleophile and the acid/base, respectively.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ALK83137.1	9.01e-150	49	695	36	674
QQY38591.1	1.79e-149	49	695	36	674
ABR38452.1	1.79e-149	49	695	36	674
QJR78498.1	5.04e-149	49	695	36	674
QJR69930.1	1.00e-148	49	695	36	674

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.001024	0.998260	0.000187	0.000181	0.000148	0.000147

TMHMM  Annotations     

start	end
13	35