CAZyme Information: MGYG000003989_01282

Basic Information

• Species: Alistipes sp002161445
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Rikenellaceae; Alistipes; Alistipes sp002161445
• CAZyme ID: MGYG000003989_01282
• CAZy Family: CBM51
• CAZyme Description: Arylsulfatase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
479		53134.76	5.2318

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003989	2451831	MAG	United Kingdom	Europe

• Gene Location: Start: 1959; End: 3398 Strand: -

Full Sequence      

MKSPLNKGLALAVVSAGAASCAPQAEEPMHRMNVIYILADDLGYGDLGCTGSTKILTPNI
DRMRAEGMLFTQHYSGSTVSAPSRSVLMTGQHTGHTPIRGNREMEGEGQTPLPAGTCTLG
RMFRQAGYVTGAFGKWGLGYPGSEGDPVYQGFDRFYGYNCQRESHRYYPTHLWDNLERVE
LEENRDGACGSYAPDLIQAEALRFLRENRDRPFFLYLPITLPHAELLVPDDEIIRSYRGK
FGEKPYLNRGGDYGPKTTVAGYCSQPEPYATFAAMVTRLDKYVGEVFALLKELGLDQNTL
VLFTSDNGPHREGGADPDFFNSSGPFRGVKRDLYEGGIRLPLIAWAPGRIEAHSTNDHVC
AFWDMLPTFAEIAGAELPDTLLQDGISIVPTLTGAGQQPEHDYLYWEFHEAGGKQAVRQG
KWKGVRQGVKKNPDAPIELYDLSTDLHEDRNVAEQYPEVVEKIAAIMQSARTESEIFKF

Enzyme Prediction     

No EC number prediction in MGYG000003989_01282.

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd16145	ARS_like	0.0	33	457	2	415	uncharacterized arylsulfatase subfamily. Sulfatases catalyze the hydrolysis of sulfate esters from wide range of substrates, including steroids, carbohydrates and proteins. Sulfate esters may be formed from various alcohols and amines. The biological roles of sulfatase includes the cycling of sulfur in the environment, in the degradation of sulfated glycosaminoglycans and glycolipids in the lysosome, and in remodeling sulfated glycosaminoglycans in the extracellular space. The sulfatases are essential for human metabolism. At least eight human monogenic diseases are caused by the deficiency of individual sulfatases.
cd16144	ARS_like	3.76e-120	33	469	2	420	uncharacterized arylsulfatase subfamily. Sulfatases catalyze the hydrolysis of sulfate esters from wide range of substrates, including steroids, carbohydrates and proteins. Sulfate esters may be formed from various alcohols and amines. The biological roles of sulfatase includes the cycling of sulfur in the environment, in the degradation of sulfated glycosaminoglycans and glycolipids in the lysosome, and in remodeling sulfated glycosaminoglycans in the extracellular space. The sulfatases are essential for human metabolism. At least eight human monogenic diseases are caused by the deficiency of individual sulfatases.
cd16026	GALNS_like	2.63e-116	33	453	3	399	galactosamine-6-sulfatase; also known as N-acetylgalactosamine-6-sulfatase (GALNS). Lysosomal galactosamine-6-sulfatase removes sulfate groups from a terminal N-acetylgalactosamine-6-sulfate (or galactose-6-sulfate) in mucopolysaccharides such as keratan sulfate and chondroitin-6-sulfate. Defects in GALNS lead to accumulation of substrates, resulting in the development of the lysosomal storage disease mucopolysaccharidosis IV A.
cd16143	ARS_like	1.48e-112	33	453	2	395	uncharacterized arylsulfatase subfamily. Sulfatases catalyze the hydrolysis of sulfate esters from wide range of substrates, including steroids, carbohydrates and proteins. Sulfate esters may be formed from various alcohols and amines. The biological roles of sulfatase includes the cycling of sulfur in the environment, in the degradation of sulfated glycosaminoglycans and glycolipids in the lysosome, and in remodeling sulfated glycosaminoglycans in the extracellular space. The sulfatases are essential for human metabolism. At least eight human monogenic diseases are caused by the deficiency of individual sulfatases.
cd16146	ARS_like	3.47e-112	33	462	2	396	uncharacterized arylsulfatase. Sulfatases catalyze the hydrolysis of sulfate esters from wide range of substrates, including steroids, carbohydrates and proteins. Sulfate esters may be formed from various alcohols and amines. The biological roles of sulfatase includes the cycling of sulfur in the environment, in the degradation of sulfated glycosaminoglycans and glycolipids in the lysosome, and in remodeling sulfated glycosaminoglycans in the extracellular space. The sulfatases are essential for human metabolism. At least eight human monogenic diseases are caused by the deficiency of individual sulfatases.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
APZ95839.1	2.91e-110	31	473	32	455
CCA60043.1	1.16e-105	12	478	30	482
QES02769.1	1.16e-105	12	478	30	482
QES09751.1	2.29e-105	33	478	46	482
QNE29543.1	2.63e-103	33	478	46	481

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
7ANA_AAA	1.10e-139	33	471	31	498	ChainAAA, N-acetylgalactosamine-6-sulfatase [Bacteroides thetaiotaomicron VPI-5482],7ANA_BBB Chain BBB, N-acetylgalactosamine-6-sulfatase [Bacteroides thetaiotaomicron VPI-5482],7ANB_AAA Chain AAA, N-acetylgalactosamine-6-sulfatase [Bacteroides thetaiotaomicron VPI-5482],7ANB_BBB Chain BBB, N-acetylgalactosamine-6-sulfatase [Bacteroides thetaiotaomicron VPI-5482]
7AN1_AAA	1.34e-131	31	477	29	502	ChainAAA, Arylsulfatase [Bacteroides thetaiotaomicron VPI-5482],7OQD_AAA Chain AAA, Arylsulfatase [Bacteroides thetaiotaomicron VPI-5482]
6PSM_A	1.96e-64	23	460	16	426	Crystalstructure of PsS1_19B C77S in complex with kappa-neocarrabiose [Pseudoalteromonas fuliginea],6PSM_B Crystal structure of PsS1_19B C77S in complex with kappa-neocarrabiose [Pseudoalteromonas fuliginea],6PSM_C Crystal structure of PsS1_19B C77S in complex with kappa-neocarrabiose [Pseudoalteromonas fuliginea],6PSM_D Crystal structure of PsS1_19B C77S in complex with kappa-neocarrabiose [Pseudoalteromonas fuliginea],6PSM_E Crystal structure of PsS1_19B C77S in complex with kappa-neocarrabiose [Pseudoalteromonas fuliginea],6PSM_F Crystal structure of PsS1_19B C77S in complex with kappa-neocarrabiose [Pseudoalteromonas fuliginea],6PSO_A Crystal structure of PsS1_19B C77S in complex with iota-neocarratetraose [Pseudoalteromonas fuliginea],6PSO_B Crystal structure of PsS1_19B C77S in complex with iota-neocarratetraose [Pseudoalteromonas fuliginea]
6PRM_A	1.06e-63	23	460	16	426	Crystalstructure of apo PsS1_19B [Pseudoalteromonas fuliginea],6PRM_B Crystal structure of apo PsS1_19B [Pseudoalteromonas fuliginea],6PRM_C Crystal structure of apo PsS1_19B [Pseudoalteromonas fuliginea],6PRM_D Crystal structure of apo PsS1_19B [Pseudoalteromonas fuliginea]
7STT_A	1.06e-58	31	473	6	435	ChainA, N-acetylgalactosamine-6-sulfatase [Pedobacter yulinensis],7STU_A Chain A, N-acetylgalactosamine-6-sulfatase [Pedobacter yulinensis],7STV_A Chain A, N-acetylgalactosamine-6-sulfatase [Pedobacter yulinensis]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q32KH5	8.50e-46	11	457	13	453	N-acetylgalactosamine-6-sulfatase OS=Canis lupus familiaris OX=9615 GN=GALNS PE=2 SV=1
P15289	1.27e-45	33	463	22	456	Arylsulfatase A OS=Homo sapiens OX=9606 GN=ARSA PE=1 SV=3
Q571E4	5.77e-45	33	423	29	397	N-acetylgalactosamine-6-sulfatase OS=Mus musculus OX=10090 GN=Galns PE=1 SV=2
Q32KJ6	3.11e-44	9	457	13	455	N-acetylgalactosamine-6-sulfatase OS=Rattus norvegicus OX=10116 GN=Galns PE=1 SV=1
P50427	4.63e-44	4	405	2	451	Steryl-sulfatase OS=Mus musculus OX=10090 GN=Sts PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as LIPO

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000296	0.127928	0.871604	0.000060	0.000064	0.000051

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003989_01282.