CAZyme Information: MGYG000003989_01343

Basic Information

• Species: Alistipes sp002161445
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Rikenellaceae; Alistipes; Alistipes sp002161445
• CAZyme ID: MGYG000003989_01343
• CAZy Family: CE8
• CAZyme Description: Pectinesterase A

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
331	MGYG000003989_100|CGC1	37008.62	5.5138

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003989	2451831	MAG	United Kingdom	Europe

• Gene Location: Start: 1526; End: 2521 Strand: -

Full Sequence      

MKYLVWGILCSLFALRVFAGEPVYTVDCNGGGDFRTVQECFDALPPKPDGWRTVRILPGT
YREKVTLDVYKDRVRIVGAGGAEQVRIVWDDHTGKVVDGHEMTTYDTWTMSLQADDVVLE
GVTVENDAGRVGQAVALETRGDRIWIDGCRLVGDQDTFFTKGYVSRVYVTDSRIEGTTDF
IFGPSIVLFDRCRIHAKSDSFITAASTTERNLYGYVFRDCRVTAADGVTRVYLGRPWKST
ARTVWIRCELPAAIRPEGWRDWHDAVRKGDVYYGEYGCTGPGADRSGRVAWSRELTGDEA
AAYTPERIFAKKTGSEAFRDDWLPAASAGKE

Enzyme Prediction     

No EC number prediction in MGYG000003989_01343.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
CE8	25	309	8.6e-87	0.9826388888888888

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PLN02432	PLN02432	3.16e-64	23	303	12	280	putative pectinesterase
PLN02773	PLN02773	1.10e-61	22	303	5	290	pectinesterase
PLN02682	PLN02682	1.60e-61	22	300	67	352	pectinesterase family protein
PLN02708	PLN02708	6.10e-55	25	304	244	538	Probable pectinesterase/pectinesterase inhibitor
pfam01095	Pectinesterase	2.42e-52	25	307	3	293	Pectinesterase.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CBK62969.1	2.74e-173	12	322	12	321
AMR29655.1	1.10e-87	25	324	16	304
QKG58922.1	2.31e-84	29	324	20	304
QEL01470.1	1.68e-82	11	327	18	331
AHM58501.1	2.68e-81	29	322	72	360

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
1XG2_A	6.28e-37	29	291	10	277	ChainA, Pectinesterase 1 [Solanum lycopersicum]
5C1E_A	1.40e-29	22	288	7	271	CrystalStructure of the Pectin Methylesterase from Aspergillus niger in Penultimately Deglycosylated Form (N-acetylglucosamine Stub at Asn84) [Aspergillus niger ATCC 1015]
5C1C_A	2.71e-29	22	288	7	271	CrystalStructure of the Pectin Methylesterase from Aspergillus niger in Deglycosylated Form [Aspergillus niger ATCC 1015]
4PMH_A	7.45e-17	112	239	154	294	Thestructure of rice weevil pectin methyl esterase [Sitophilus oryzae]
2NSP_A	9.61e-16	21	324	5	339	ChainA, Pectinesterase A [Dickeya dadantii 3937],2NSP_B Chain B, Pectinesterase A [Dickeya dadantii 3937],2NST_A Chain A, Pectinesterase A [Dickeya dadantii 3937],2NST_B Chain B, Pectinesterase A [Dickeya dadantii 3937],2NT6_A Chain A, Pectinesterase A [Dickeya dadantii 3937],2NT6_B Chain B, Pectinesterase A [Dickeya dadantii 3937],2NT9_A Chain A, Pectinesterase A [Dickeya dadantii 3937],2NT9_B Chain B, Pectinesterase A [Dickeya dadantii 3937]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q9SIJ9	3.53e-49	18	327	45	337	Putative pectinesterase 11 OS=Arabidopsis thaliana OX=3702 GN=PME11 PE=3 SV=1
Q9LVQ0	2.23e-48	26	303	9	290	Pectinesterase 31 OS=Arabidopsis thaliana OX=3702 GN=PME31 PE=1 SV=1
Q9FM79	2.67e-48	23	323	81	378	Pectinesterase QRT1 OS=Arabidopsis thaliana OX=3702 GN=QRT1 PE=1 SV=1
Q8VYZ3	3.05e-47	22	303	81	369	Probable pectinesterase 53 OS=Arabidopsis thaliana OX=3702 GN=PME53 PE=2 SV=1
Q9LY18	1.34e-41	19	303	62	343	Probable pectinesterase 49 OS=Arabidopsis thaliana OX=3702 GN=PME49 PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000406	0.998816	0.000238	0.000171	0.000168	0.000165

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003989_01343.