CAZyme Information: MGYG000003989_01975

Basic Information

• Species: Alistipes sp002161445
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Rikenellaceae; Alistipes; Alistipes sp002161445
• CAZyme ID: MGYG000003989_01975
• CAZy Family: GT19
• CAZyme Description: Lipid-A-disaccharide synthase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
168		18676.57	5.3328

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003989	2451831	MAG	United Kingdom	Europe

• Gene Location: Start: 61; End: 567 Strand: +

Full Sequence      

MARLAERFPGHQFVVAGVPWLDPALYEEHIAGSPIRYVCDQTYETLAAAEAAVVASGTAT
LETALLGIPEVVVYRLAPLEYYGMPLVVRCPWVSLVNLNLRREAVAEVLQSNLDITRAER
ELRAILPGGEKRQRMLADFEELRTVIGGPGASDRFARRMVELLKNRES

Enzyme Prediction     

No EC number prediction in MGYG000003989_01975.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT19	2	145	9.3e-34	0.4011299435028249

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK00025	lpxB	1.08e-25	1	168	211	380	lipid-A-disaccharide synthase; Reviewed
COG0763	LpxB	1.24e-23	1	164	213	380	Lipid A disaccharide synthetase [Cell wall/membrane/envelope biogenesis].
pfam02684	LpxB	7.01e-14	2	142	211	358	Lipid-A-disaccharide synthetase. This is a family of lipid-A-disaccharide synthetases, EC:2.4.2.128. These enzymes catalyze the reaction: UDP-2,3-bis(3-hydroxytetradecanoyl) glucosamine + 2,3-bis(3-hydroxytetradecanoyl)-beta-D-glucosaminyl 1-phosphate <=> UDP + 2,3-bis(3-hydroxytetradecanoyl)-D-glucosaminyl-1,6 -beta-D-2,3-bis(3-hydroxytetradecanoyl)-beta-D-glucosaminyl 1-phosphate. These enzymes catalyze the fist disaccharide step in the synthesis of lipid-A-disaccharide.
PRK14089	PRK14089	2.04e-04	56	98	243	285	lipid-A-disaccharide synthase.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BBL11605.1	1.38e-75	1	168	211	378
BBL00808.1	1.38e-75	1	168	211	378
BBL08813.1	1.38e-75	1	168	211	378
AFL77950.1	1.95e-75	1	168	211	378
BBL06737.1	5.18e-70	1	165	211	375

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5W8N_A	1.12e-08	44	162	263	380	LipidA Disaccharide Synthase (LpxB)-6 solubilizing mutations [Escherichia coli BL21(DE3)]
5W8S_A	1.12e-08	44	162	263	380	LipidA Disaccharide Synthase (LpxB)-7 solubilizing mutations [Escherichia coli BL21(DE3)],5W8X_A Lipid A Disaccharide Synthase (LpxB)-7 solubilizing mutations-Bound to UDP [Escherichia coli BL21(DE3)]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q1D393	1.67e-18	3	163	216	378	Lipid-A-disaccharide synthase OS=Myxococcus xanthus (strain DK1622) OX=246197 GN=lpxB PE=3 SV=1
Q2LVL8	3.17e-18	4	167	216	382	Lipid-A-disaccharide synthase OS=Syntrophus aciditrophicus (strain SB) OX=56780 GN=lpxB PE=3 SV=1
B8JE78	5.99e-18	3	164	219	383	Lipid-A-disaccharide synthase OS=Anaeromyxobacter dehalogenans (strain 2CP-1 / ATCC BAA-258) OX=455488 GN=lpxB PE=3 SV=1
B4UHR6	8.24e-18	3	164	219	383	Lipid-A-disaccharide synthase OS=Anaeromyxobacter sp. (strain K) OX=447217 GN=lpxB PE=3 SV=1
Q2IL69	8.24e-18	3	164	219	383	Lipid-A-disaccharide synthase OS=Anaeromyxobacter dehalogenans (strain 2CP-C) OX=290397 GN=lpxB PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000057	0.000004	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003989_01975.