CAZyme Information: MGYG000003990_00507

Basic Information

• Species: Ruminococcus_E sp900314705
• Lineage: Bacteria; Firmicutes_A; Clostridia; Oscillospirales; Acutalibacteraceae; Ruminococcus_E; Ruminococcus_E sp900314705
• CAZyme ID: MGYG000003990_00507
• CAZy Family: CBM21
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
251	MGYG000003990_3|CGC1	28172.22	4.9874

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003990	2132910	MAG	United Kingdom	Europe

• Gene Location: Start: 104118; End: 104873 Strand: -

Full Sequence      

MTKKRLIPFAVVLVMLFSIFSAIPSAGATSTTPVKLIYATPNGVDGIGASGYIEVENIAY
EKNVTVHYSYNGIDWYDCSAQYYKPTHGNYEAWSFATPGISRPGGDLPVTVQFAIKYEVN
GNTYWDNNNGNNYKVYSGYHAPSFYDFGCGGVKNYYSFIDLSNNFTGAVQLKNLGYEKDV
KVVYSTDNWKTTKNVNASFEYTSNPYVENAIEVWYYSVPVNDNSLQYRIEYTVNGTTYVD
DNFGANYTVTK

Enzyme Prediction     

No EC number prediction in MGYG000003990_00507.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
CBM21	50	135	8e-21	0.8130841121495327
CBM21	161	249	5.6e-16	0.8598130841121495

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam03370	CBM_21	1.11e-21	51	135	23	112	Carbohydrate/starch-binding module (family 21). This family consists of several eukaryotic proteins that are thought to be involved in the regulation of glycogen metabolism. For instance, the mouse PTG protein has been shown to interact with glycogen synthase, phosphorylase kinase, phosphorylase a: these three enzymes have key roles in the regulation of glycogen metabolism. PTG also binds the catalytic subunit of protein phosphatase 1 (PP1C) and localizes it to glycogen. Subsets of similar interactions have been observed with several other members of this family, such as the yeast PIG1, PIG2, GAC1 and GIP2 proteins. While the precise function of these proteins is not known, they may serve a scaffold function, bringing together the key enzymes in glycogen metabolism. This family is a carbohydrate binding domain.
pfam03370	CBM_21	3.97e-13	166	250	22	113	Carbohydrate/starch-binding module (family 21). This family consists of several eukaryotic proteins that are thought to be involved in the regulation of glycogen metabolism. For instance, the mouse PTG protein has been shown to interact with glycogen synthase, phosphorylase kinase, phosphorylase a: these three enzymes have key roles in the regulation of glycogen metabolism. PTG also binds the catalytic subunit of protein phosphatase 1 (PP1C) and localizes it to glycogen. Subsets of similar interactions have been observed with several other members of this family, such as the yeast PIG1, PIG2, GAC1 and GIP2 proteins. While the precise function of these proteins is not known, they may serve a scaffold function, bringing together the key enzymes in glycogen metabolism. This family is a carbohydrate binding domain.
pfam16760	CBM53	3.02e-06	57	135	1	75	Starch/carbohydrate-binding module (family 53).

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QCT07351.1	1.32e-169	1	251	1	251
QUH30304.1	7.42e-49	3	247	2	257
QNK41593.1	9.19e-47	4	248	8	241
AIQ70729.1	1.44e-45	47	251	48	254
CQR53753.1	5.70e-45	47	251	48	254

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
2DJM_A	1.41e-11	45	135	17	104	ChainA, glucoamylase A [Rhizopus arrhizus],2V8L_A Chain A, Glucoamylase A [Rhizopus arrhizus],2V8M_A Chain A, Glucoamylase A [Rhizopus arrhizus],2V8M_B Chain B, Glucoamylase A [Rhizopus arrhizus],2V8M_C Chain C, Glucoamylase A [Rhizopus arrhizus],2V8M_D Chain D, Glucoamylase A [Rhizopus arrhizus],2VQ4_A Chain A, GLUCOAMYLASE A [Rhizopus arrhizus],4BFN_A Chain A, Glucoamylase [Rhizopus arrhizus],4BFO_A Chain A, Glucoamylase [Rhizopus arrhizus]
2EEF_A	8.61e-08	50	135	49	135	ChainA, Protein phosphatase 1, regulatory (Inhibitor) subunit 3B [Homo sapiens]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P07683	8.10e-11	7	135	6	129	Glucoamylase 1 OS=Rhizopus oryzae OX=64495 PE=1 SV=2
Q6GL23	2.71e-08	35	136	110	209	Protein phosphatase 1 regulatory subunit 3C OS=Xenopus tropicalis OX=8364 GN=ppp1r3c PE=2 SV=1
Q86XI6	1.59e-06	50	135	146	232	Protein phosphatase 1 regulatory subunit 3B OS=Homo sapiens OX=9606 GN=PPP1R3B PE=1 SV=1
Q9UQK1	7.80e-06	50	135	170	256	Protein phosphatase 1 regulatory subunit 3C OS=Homo sapiens OX=9606 GN=PPP1R3C PE=1 SV=2
Q99MR9	9.20e-06	35	133	129	228	Protein phosphatase 1 regulatory subunit 3A OS=Mus musculus OX=10090 GN=Ppp1r3a PE=1 SV=2

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000602	0.998445	0.000276	0.000264	0.000207	0.000186

TMHMM  Annotations     

start	end
7	29