CAZyme Information: MGYG000003990_01779

Basic Information

• Species: Ruminococcus_E sp900314705
• Lineage: Bacteria; Firmicutes_A; Clostridia; Oscillospirales; Acutalibacteraceae; Ruminococcus_E; Ruminococcus_E sp900314705
• CAZyme ID: MGYG000003990_01779
• CAZy Family: CBM26
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
431		46627.55	5.0872

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003990	2132910	MAG	United Kingdom	Europe

• Gene Location: Start: 20512; End: 21807 Strand: +

Full Sequence      

MKTLCKKSFGVFLAVLMLLSAVGVGSYSVFAANTNTEKSGATSASGDTVYFQNTGNWSKV
NAYMWYEGKSNANNKAWPGEAMTDEGDGVWSYDIKGEYDHIIFNNGSAQTGDITYPGNSM
IYKDGKWEVYDTSPLRITSFESDTKSPAYIGSAIALTTTTKTETTGVQYQYSVNSQVIRS
YSADNSCVWNPVASGDYTVRVDVKDNAGNQNFREMSFTIKDPSQEQKPVFLSSNPLTGNQ
IKTGTATNLSVNAAGGNTGTKLLFYKYVVKDPSGEQVNTAYYTLNKNYSFTATKSGTYTV
DVSVQGSDNQTITQQLKFVSTQNPTDPTVPTEPTVTTPSKTEPTVTTPSKTDPTVTTPTT
ATEPSTPDPSKILGDVNGDGVLNVRDSSLIQKKHTGMVVNSYDETVSDFNKDGKMNVKDA
VAIQKFLAKAN

Enzyme Prediction     

No EC number prediction in MGYG000003990_01779.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
CBM26	48	112	8.7e-19	0.8933333333333333

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam16738	CBM26	8.85e-18	49	114	1	68	Starch-binding module 26. CBM26 is a carbohydrate-binding module that binds starch.
cd14256	Dockerin_I	3.42e-09	373	428	1	57	Type I dockerin repeat domain. Bacterial cohesin domains bind to a complementary protein domain named dockerin, and this interaction is required for the formation of the cellulosome, a cellulose-degrading complex. The cellulosome consists of scaffoldin, a noncatalytic scaffolding polypeptide, that comprises repeating cohesion modules and a single carbohydrate-binding module (CBM). Specific calcium-dependent interactions between cohesins and dockerins appear to be essential for cellulosome assembly. This subfamily represents type I dockerins, which are responsible for anchoring a variety of enzymatic domains to the complex.
PRK14081	PRK14081	9.59e-09	129	305	280	457	triple tyrosine motif-containing protein; Provisional
cd14254	Dockerin_II	3.08e-06	374	427	1	53	Type II dockerin repeat domain. Bacterial cohesin domains bind to a complementary protein domain named dockerin, and this interaction is required for the formation of the cellulosome, a cellulose-degrading complex. The cellulosome consists of scaffoldin, a noncatalytic scaffolding polypeptide, that comprises repeating cohesion modules and a single carbohydrate-binding module (CBM). Specific calcium-dependent interactions between cohesins and dockerins appear to be essential for cellulosome assembly. This subfamily represents type II dockerins, which are responsible for mediating attachment of the cellulosome complex to the bacterial cell wall.
pfam00404	Dockerin_1	7.25e-06	374	427	1	55	Dockerin type I repeat. The dockerin repeat is the binding partner of the cohesin domain pfam00963. The cohesin-dockerin interaction is the crucial interaction for complex formation in the cellulosome. The dockerin repeats, each bearing homology to the EF-hand calcium-binding loop bind calcium.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QCT07167.1	6.38e-238	1	431	1	424
CDM67894.1	1.07e-16	50	308	584	935
QCT07491.1	1.00e-15	12	224	7	209
QWV86167.1	5.92e-14	48	136	840	933
QXF05156.1	1.85e-13	48	136	840	933

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P00691	3.19e-06	44	117	560	639	Alpha-amylase OS=Bacillus subtilis (strain 168) OX=224308 GN=amyE PE=1 SV=2

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000777	0.998296	0.000266	0.000264	0.000188	0.000159

TMHMM  Annotations     

start	end
9	31