CAZyme Information: MGYG000003992_00182

Basic Information

• Species: 43-108 sp001915545
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; 43-108; 43-108 sp001915545
• CAZyme ID: MGYG000003992_00182
• CAZy Family: GT51
• CAZyme Description: Biosynthetic peptidoglycan transglycosylase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
241	MGYG000003992_2|CGC2	27735.08	8.7562

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003992	3355495	MAG	United Kingdom	Europe

• Gene Location: Start: 23691; End: 24416 Strand: +

Full Sequence      

MTLSPLKIIGNIVKWCVIAFLGSSILGVIAYRYLPVEFTPLMFIRCYQQVKNGEEIRLKH
KWVDMDEISPDLALAVWSSEDQNFIKHNGFDFTQIKNAIKEKAEGGRSRGASTISQQTAK
NVFLWPTSSWTRKGFEVYFTVLIEMFWSKERIMEVYLNSIEMGDGIYGAEAVAQLHFGCK
ASELSRQQCALIAATLPNPIKFNSASPSRYMYKRQGWILRQMRNLGHFPSKEEIEEMRKE
D

Enzyme Prediction     

No EC number prediction in MGYG000003992_00182.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT51	59	223	9.6e-52	0.9322033898305084

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK00056	mtgA	4.85e-114	4	226	3	227	monofunctional biosynthetic peptidoglycan transglycosylase; Provisional
TIGR02070	mono_pep_trsgly	4.67e-83	7	226	2	222	monofunctional biosynthetic peptidoglycan transglycosylase. This family is one of the transglycosylases involved in the late stages of peptidoglycan biosynthesis. Members tend to be small, about 240 amino acids in length, and consist almost entirely of a domain described by pfam00912 for transglycosylases. Species with this protein will have several other transglycosylases as well. All species with this protein are Proteobacteria that produce murein (peptidoglycan). [Cell envelope, Biosynthesis and degradation of murein sacculus and peptidoglycan]
pfam00912	Transgly	4.64e-65	52	223	1	177	Transglycosylase. The penicillin-binding proteins are bifunctional proteins consisting of transglycosylase and transpeptidase in the N- and C-terminus respectively. The transglycosylase domain catalyzes the polymerization of murein glycan chains.
COG0744	MrcB	1.03e-64	5	241	8	258	Membrane carboxypeptidase (penicillin-binding protein) [Cell wall/membrane/envelope biogenesis].
COG5009	MrcA	4.92e-38	5	240	1	247	Membrane carboxypeptidase/penicillin-binding protein [Cell wall/membrane/envelope biogenesis].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QNT65514.1	9.29e-101	9	233	6	230
QVJ81082.1	2.18e-100	6	231	1	228
ALO48142.1	4.77e-96	6	233	1	228
ADE82296.1	2.14e-95	20	231	3	216
QQY44710.1	3.44e-94	5	233	3	227

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3NB6_A	4.38e-27	59	239	19	200	Crystalstructure of Aquifex aeolicus peptidoglycan glycosyltransferase in complex with Methylphosphoryl Neryl Moenomycin [Aquifex aeolicus]
2OQO_A	1.21e-26	59	239	19	200	Crystalstructure of a peptidoglycan glycosyltransferase from a class A PBP: insight into bacterial cell wall synthesis [Aquifex aeolicus VF5],3D3H_A Crystal structure of a complex of the peptidoglycan glycosyltransferase domain from Aquifex aeolicus and neryl moenomycin A [Aquifex aeolicus],3NB7_A Crystal structure of Aquifex Aeolicus Peptidoglycan Glycosyltransferase in complex with Decarboxylated Neryl Moenomycin [Aquifex aeolicus]
4OON_A	4.93e-23	53	226	35	206	Crystalstructure of PBP1a in complex with compound 17 ((4Z,8S,11E,14S)-5-(2-amino-1,3-thiazol-4-yl)-14-(5,6-dihydroxy-1,3-dioxo-1,3-dihydro-2H-isoindol-2-yl)-8-formyl-2-methyl-6-oxo-3,10-dioxa-4,7,11-triazatetradeca-4,11-diene-2,12,14-tricarboxylic acid) [Pseudomonas aeruginosa PAO1]
3DWK_A	6.83e-20	51	219	13	187	ChainA, Penicillin-binding protein 2 [Staphylococcus aureus subsp. aureus COL],3DWK_B Chain B, Penicillin-binding protein 2 [Staphylococcus aureus subsp. aureus COL],3DWK_C Chain C, Penicillin-binding protein 2 [Staphylococcus aureus subsp. aureus COL],3DWK_D Chain D, Penicillin-binding protein 2 [Staphylococcus aureus subsp. aureus COL]
5U2G_A	1.37e-19	53	240	36	220	2.6Angstrom Resolution Crystal Structure of Penicillin-Binding Protein 1A from Haemophilus influenzae [Haemophilus influenzae Rd KW20],5U2G_B 2.6 Angstrom Resolution Crystal Structure of Penicillin-Binding Protein 1A from Haemophilus influenzae [Haemophilus influenzae Rd KW20]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q8A8H2	9.71e-93	5	232	6	233	Biosynthetic peptidoglycan transglycosylase OS=Bacteroides thetaiotaomicron (strain ATCC 29148 / DSM 2079 / JCM 5827 / CCUG 10774 / NCTC 10582 / VPI-5482 / E50) OX=226186 GN=mtgA PE=3 SV=1
Q3V815	1.73e-88	5	229	6	226	Biosynthetic peptidoglycan transglycosylase OS=Bacteroides fragilis (strain YCH46) OX=295405 GN=mtgA PE=3 SV=1
Q3V7G2	1.73e-88	5	229	6	226	Biosynthetic peptidoglycan transglycosylase OS=Bacteroides fragilis (strain ATCC 25285 / DSM 2151 / CCUG 4856 / JCM 11019 / NCTC 9343 / Onslow) OX=272559 GN=mtgA PE=3 SV=1
B0KN61	4.18e-69	20	226	16	222	Biosynthetic peptidoglycan transglycosylase OS=Pseudomonas putida (strain GB-1) OX=76869 GN=mtgA PE=3 SV=1
Q88CS3	4.18e-69	20	226	16	222	Biosynthetic peptidoglycan transglycosylase OS=Pseudomonas putida (strain ATCC 47054 / DSM 6125 / CFBP 8728 / NCIMB 11950 / KT2440) OX=160488 GN=mtgA PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000031	0.000002	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

start	end
12	34