CAZyme Information: MGYG000003992_00622

Basic Information

• Species: 43-108 sp001915545
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; 43-108; 43-108 sp001915545
• CAZyme ID: MGYG000003992_00622
• CAZy Family: GT83
• CAZyme Description: Undecaprenyl phosphate-alpha-4-amino-4-deoxy-L-arabinose arabinosyl transferase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
570	MGYG000003992_5|CGC2	64754.68	8.887

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003992	3355495	MAG	United Kingdom	Europe

• Gene Location: Start: 99821; End: 101533 Strand: -

Full Sequence      

MKTNKAFWILLAVCALSILPFIGQTEFYTKGEPRESVVALTMLKTGNWILPENNGGDIPY
KPPFFHWCIAAFSLITGSVNEYTSRLPSALAVIVMTMAGFCFFARRRGVQVAFIASAVLF
TAFEIHRAGVNCRVDMVLTAAVVCAIYSLYRWWERGLKGFPLVAVLCMSVATLTKGPVGA
LLPCLVAGVFLLLHGYKFWRVFLYMFGLGICSMVLPLCWYVAAYQQGGESFLSLVCEENF
GRFTGQMTYESHEEPLYYNFITLISGFAPWTLLILFSLFGLKYKKPDCTFKQFFNRMWTG
FRGMDPCRQYSLLAAVLIFVFYCIPSSKRSVYIMPVYPFVAYFIAEYMLWLVKKHSLSVK
IYGSVLSVVFILVFLVFVIVKLDFVPSSLISGKNAAENMALIRSLSDVNIFISLFALVPI
VLSAMWMACERHMVTVRHLYLLIALTFGFYIAFDAVYQPAVLKPQSVKGLAAKVNEIVPE
GNIYSFKEVDLKEYGNPLHFFGLNYYLNDRVRIFAKDKPAEGYIWMTVDDAYGIFADVFP
DYELEEVFRADRRYDGAKAIQGLFKFKKVR

Enzyme Prediction     

No EC number prediction in MGYG000003992_00622.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT83	3	459	1.3e-79	0.7981481481481482

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG1807	ArnT	9.17e-30	1	379	4	365	4-amino-4-deoxy-L-arabinose transferase or related glycosyltransferase of PMT family [Cell wall/membrane/envelope biogenesis].
pfam13231	PMT_2	6.79e-07	61	199	2	137	Dolichyl-phosphate-mannose-protein mannosyltransferase. This family contains members that are not captured by pfam02366.
PRK13279	arnT	1.78e-06	42	380	43	365	lipid IV(A) 4-amino-4-deoxy-L-arabinosyltransferase.
pfam10131	PTPS_related	1.37e-05	60	231	3	176	6-pyruvoyl-tetrahydropterin synthase related domain; membrane protein. This domain is found in various bacterial hypothetical membrane proteins, as well as in tetratricopeptide TPR_2 repeat protein. The exact function of the domain has not, as yet, been established.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CAJ74247.1	7.46e-33	10	347	10	342
CAJ73913.1	3.68e-29	2	346	31	355
BAU11215.1	1.27e-25	8	358	24	359
AFZ43689.1	1.49e-24	9	338	29	373
BAS59114.1	4.14e-24	8	368	22	365

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5EZM_A	1.06e-12	8	338	33	354	CrystalStructure of ArnT from Cupriavidus metallidurans in the apo state [Cupriavidus metallidurans CH34],5F15_A Crystal Structure of ArnT from Cupriavidus metallidurans bound to Undecaprenyl phosphate [Cupriavidus metallidurans CH34]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
O67270	6.00e-17	10	348	6	321	Uncharacterized protein aq_1220 OS=Aquifex aeolicus (strain VF5) OX=224324 GN=aq_1220 PE=3 SV=1
O67601	1.58e-12	32	395	30	349	Uncharacterized protein aq_1704 OS=Aquifex aeolicus (strain VF5) OX=224324 GN=aq_1704 PE=3 SV=1
B4TBG8	4.50e-09	1	365	2	347	Undecaprenyl phosphate-alpha-4-amino-4-deoxy-L-arabinose arabinosyl transferase OS=Salmonella heidelberg (strain SL476) OX=454169 GN=arnT PE=3 SV=1
B5XTL1	2.22e-07	10	365	10	349	Undecaprenyl phosphate-alpha-4-amino-4-deoxy-L-arabinose arabinosyl transferase OS=Klebsiella pneumoniae (strain 342) OX=507522 GN=arnT PE=3 SV=1
A6TF96	2.92e-07	10	365	10	349	Undecaprenyl phosphate-alpha-4-amino-4-deoxy-L-arabinose arabinosyl transferase OS=Klebsiella pneumoniae subsp. pneumoniae (strain ATCC 700721 / MGH 78578) OX=272620 GN=arnT PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.505273	0.492271	0.000949	0.000449	0.000431	0.000619

TMHMM  Annotations     

start	end
7	24
82	104
136	153
173	195
202	224
259	281
310	327
332	351
358	380
408	427
439	461