CAZyme Information: MGYG000003992_00806

Basic Information

• Species: 43-108 sp001915545
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; 43-108; 43-108 sp001915545
• CAZyme ID: MGYG000003992_00806
• CAZy Family: CBM13
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
670		75249.1	6.3029

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003992	3355495	MAG	United Kingdom	Europe

• Gene Location: Start: 12958; End: 14970 Strand: -

Full Sequence      

MFSLRQLFLLLAFLCFLFVPEQAFCDGVVHPGGLHTKADLDRMKQMVAERKHPWIDGWEE
LQKDPWAKSDFKAHAMSNMGKSRQIASVDAHAVYLNAVRWYISGDESYARCAIDICNAWS
DSIDQIPVSKQDQGLLGIPIGEFAMAAEVLRVCPLWEKKDFERFKKMMIDYLYPVSRDFL
RTHGGGNVDYCWTNWDACNMVALAAIGVLCDREDIYREAIDYFKYGAGNGSIANAVPHLH
RMDDGTVLGQWQESGRDQEHAQLGVGFLASLCQIAWNQGDDLFSYDNNRLLAGAEYVARH
NQMRGVPFAFYDNSQGLNNKWPSINGLGRLEDRPVWEMIYNHYEVLKGVPAPYSKRMAEL
LRPEHGSKDHFGYGTLTFTQRQSEFPPLPVPAVPAGLVAEASLGLVRLEWNPSAGYYANG
YIIERSDNGGEFREIARYEEKVTNNYVDRKVETGNKYEYRVAAVNRTGVSRFSESVKTTV
PVVDGLPEGWCCSEIGAVDSCTVGYSPALGGCISLGCASAVDGRTFDNLPFVYKSVTGNF
SFSCRINAIDGSVDECGLMARASLDSCSQTVTMTLGHWGRRFARMGWRSESGHSRRFVNG
NTYTWIPAWFRLVRVGDVFYSYESPDGVNWFYVHSERVSMPETVYIGVAGFFKKGKSTNN
AVFDKLSLFC

Enzyme Prediction     

No EC number prediction in MGYG000003992_00806.

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam05426	Alginate_lyase	3.00e-20	89	300	57	267	Alginate lyase. This family contains several bacterial alginate lyase proteins. Alginate is a family of 1-4-linked copolymers of beta -D-mannuronic acid (M) and alpha -L-guluronic acid (G). It is produced by brown algae and by some bacteria belonging to the genera Azotobacter and Pseudomonas. Alginate lyases catalyze the depolymerization of alginates by beta -elimination, generating a molecule containing 4-deoxy-L-erythro-hex-4-enepyranosyluronate at the nonreducing end. This family adopts an all alpha fold.
cd00063	FN3	8.89e-09	406	480	17	93	Fibronectin type 3 domain; One of three types of internal repeats found in the plasma protein fibronectin. Its tenth fibronectin type III repeat contains an RGD cell recognition sequence in a flexible loop between 2 strands. Approximately 2% of all animal proteins contain the FN3 repeat; including extracellular and intracellular proteins, membrane spanning cytokine receptors, growth hormone receptors, tyrosine phosphatase receptors, and adhesion molecules. FN3-like domains are also found in bacterial glycosyl hydrolases.
smart00060	FN3	1.28e-05	406	470	17	83	Fibronectin type 3 domain. One of three types of internal repeat within the plasma protein, fibronectin. The tenth fibronectin type III repeat contains a RGD cell recognition sequence in a flexible loop between 2 strands. Type III modules are present in both extracellular and intracellular proteins.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AXP82777.1	1.40e-210	14	668	24	676
AXP82778.1	5.91e-144	22	668	23	675
BAV06996.1	8.30e-91	23	389	15	389
QDA29257.1	8.48e-89	19	391	26	413
AUS26685.1	2.33e-88	19	391	26	413

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000179	0.999252	0.000150	0.000145	0.000128	0.000125

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003992_00806.