CAZyme Information: MGYG000003992_00928

Basic Information

• Species: 43-108 sp001915545
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; 43-108; 43-108 sp001915545
• CAZyme ID: MGYG000003992_00928
• CAZy Family: GH2
• CAZyme Description: Beta-galactosidase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
924	MGYG000003992_9|CGC1	104260.65	6.0793

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003992	3355495	MAG	United Kingdom	Europe

• Gene Location: Start: 47633; End: 50407 Strand: +

Full Sequence      

MKKTFISLLLTASICGYANDRDVLDLSGKWTVGLDSTDIGLTENWQERLFTTPISLPGTT
DGAGLGIENTLKPALTKPQLTYLTRKHKHVGPAWYSRNIEIPKDWNGKDIFLTLERAMWD
TQVWIDGKKVEGHEESLVTPHHYDITRYVTPGSKHLISIRVDNRKRYDISNGMAHAYTNH
TQIIWNGILGDMEIQAKDPVRIETVDLYPDLNSNNVKAVIEISNNSGSEREAVIQFGVKG
LKDIAPSKKTVALKKGVNRIETVQDMGNSYVKWSEFTPEIYTASVSLESEGMKSQKEETF
GMRELKRDGNKLILNDAPLFLRGTLECCIFPLTGTPPMDKKGWKKVFSAAKEYGLNHLRF
HSWCPPEAAFEAADEMGFYLQIELPAWVLTIGKSPDAVRFLRAEAENIRREYGNHPSLCL
WSLGNELQGDFRILSDMLDELKAKDSRHLYTTTSFTFENGHGRWPEKNDDYFVTQWTKKG
WVRGQGVFNQEVPSFDKNYNASVEGMEVPLITHEVGQYSVYPDLNEIKKYKGVLMPLNFM
AVKEDLIKKGLIDKADDYLKSSGKLAAILYKEEIERALKTAGISGFQLLDLHDFPGQGTA
LVGLLNAFWESKGIIDGKDFREFCSPVVPLLNFPKAIYLNSETFNGEFVVCNYGKSVLHN
KNIEWTVSCNGKKISSGKTQVSSLGIGYNGELGTMSVPLANITEASKLEIELGIEGTDYK
NRWNIWVYPDNQTVEWGDVVYTRDFAEAESLLAQGKKVLFNPDWKTMKGIEGKFVPVFWS
PVHFPNQAGTMGLLCNPKHDVLKQFPTDSYTDWQWWDLNINSTTLITDNLKGGDAIVEMI
DNFANNRKLASLYEGQVGNGKLMLATFDLERNLDKRPVAKQMLISILDYMNSDKFNPSVL
SNFDVLKDIVGKTENNKQSAEGIY

Enzyme Prediction     

No EC number prediction in MGYG000003992_00928.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH2	19	679	8e-70	0.675531914893617

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG3250	LacZ	3.59e-22	20	460	9	442	Beta-galactosidase/beta-glucuronidase [Carbohydrate transport and metabolism].
PRK10150	PRK10150	9.12e-20	21	426	10	417	beta-D-glucuronidase; Provisional
pfam02837	Glyco_hydro_2_N	3.71e-07	26	163	4	135	Glycosyl hydrolases family 2, sugar binding domain. This family contains beta-galactosidase, beta-mannosidase and beta-glucuronidase activities and has a jelly-roll fold. The domain binds the sugar moiety during the sugar-hydrolysis reaction.
pfam00703	Glyco_hydro_2	9.42e-07	200	303	1	106	Glycosyl hydrolases family 2. This family contains beta-galactosidase, beta-mannosidase and beta-glucuronidase activities.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QCQ32061.1	0.0	1	918	1	919
AUI45834.1	0.0	1	918	1	919
QKH84659.1	0.0	1	918	1	919
QTO27677.1	0.0	1	909	1	912
QCQ54210.1	0.0	1	909	1	912

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6S6Z_A	4.21e-18	44	426	69	440	Structureof beta-Galactosidase from Thermotoga maritima [Thermotoga maritima MSB8],6S6Z_B Structure of beta-Galactosidase from Thermotoga maritima [Thermotoga maritima MSB8],6S6Z_C Structure of beta-Galactosidase from Thermotoga maritima [Thermotoga maritima MSB8],6S6Z_D Structure of beta-Galactosidase from Thermotoga maritima [Thermotoga maritima MSB8],6S6Z_E Structure of beta-Galactosidase from Thermotoga maritima [Thermotoga maritima MSB8],6S6Z_F Structure of beta-Galactosidase from Thermotoga maritima [Thermotoga maritima MSB8],6S6Z_G Structure of beta-Galactosidase from Thermotoga maritima [Thermotoga maritima MSB8],6S6Z_H Structure of beta-Galactosidase from Thermotoga maritima [Thermotoga maritima MSB8]
6SD0_A	4.21e-18	44	426	70	441	Structureof beta-galactosidase from Thermotoga maritima. [Thermotoga maritima MSB8],6SD0_B Structure of beta-galactosidase from Thermotoga maritima. [Thermotoga maritima MSB8],6SD0_C Structure of beta-galactosidase from Thermotoga maritima. [Thermotoga maritima MSB8],6SD0_D Structure of beta-galactosidase from Thermotoga maritima. [Thermotoga maritima MSB8]
6D89_A	2.15e-17	77	449	91	439	Bacteroidesuniformis beta-glucuronidase 1 with N-terminal loop deletion [Bacteroides uniformis],6D89_B Bacteroides uniformis beta-glucuronidase 1 with N-terminal loop deletion [Bacteroides uniformis],6D89_C Bacteroides uniformis beta-glucuronidase 1 with N-terminal loop deletion [Bacteroides uniformis],6D89_D Bacteroides uniformis beta-glucuronidase 1 with N-terminal loop deletion [Bacteroides uniformis]
6D1N_A	2.20e-17	77	449	99	447	Apostructure of Bacteroides uniformis Beta-glucuronidase 1 [Bacteroides uniformis],6D1N_B Apo structure of Bacteroides uniformis Beta-glucuronidase 1 [Bacteroides uniformis],6D41_A Bacteriodes uniformis beta-glucuronidase 1 bound to D-glucaro-1,5-lactone [Bacteroides uniformis],6D41_B Bacteriodes uniformis beta-glucuronidase 1 bound to D-glucaro-1,5-lactone [Bacteroides uniformis],6D6W_A Bacteroides uniformis beta-glucuronidase 1 bound to glucuronate [Bacteroides uniformis],6D6W_B Bacteroides uniformis beta-glucuronidase 1 bound to glucuronate [Bacteroides uniformis],6D6W_C Bacteroides uniformis beta-glucuronidase 1 bound to glucuronate [Bacteroides uniformis],6D6W_D Bacteroides uniformis beta-glucuronidase 1 bound to glucuronate [Bacteroides uniformis],6D7F_A Bacteroides uniformis beta-glucuronidase 1 bound to thiophenyl-beta-D-glucuronide [Bacteroides uniformis],6D7F_B Bacteroides uniformis beta-glucuronidase 1 bound to thiophenyl-beta-D-glucuronide [Bacteroides uniformis],6D7F_C Bacteroides uniformis beta-glucuronidase 1 bound to thiophenyl-beta-D-glucuronide [Bacteroides uniformis],6D7F_D Bacteroides uniformis beta-glucuronidase 1 bound to thiophenyl-beta-D-glucuronide [Bacteroides uniformis],6D7F_E Bacteroides uniformis beta-glucuronidase 1 bound to thiophenyl-beta-D-glucuronide [Bacteroides uniformis],6D7F_F Bacteroides uniformis beta-glucuronidase 1 bound to thiophenyl-beta-D-glucuronide [Bacteroides uniformis]
6ECA_A	2.58e-15	26	426	43	439	Lactobacillusrhamnosus Beta-glucuronidase [Lacticaseibacillus rhamnosus],6ECA_B Lactobacillus rhamnosus Beta-glucuronidase [Lacticaseibacillus rhamnosus]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q56307	2.31e-17	44	426	70	441	Beta-galactosidase OS=Thermotoga maritima (strain ATCC 43589 / DSM 3109 / JCM 10099 / NBRC 100826 / MSB8) OX=243274 GN=lacZ PE=1 SV=2
T2KPJ7	3.14e-14	1	427	27	431	Putative beta-glucuronidase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_21970 PE=2 SV=1
P05804	6.49e-13	21	524	10	520	Beta-glucuronidase OS=Escherichia coli (strain K12) OX=83333 GN=uidA PE=1 SV=2
Q04F24	3.68e-12	21	426	45	457	Beta-galactosidase OS=Oenococcus oeni (strain ATCC BAA-331 / PSU-1) OX=203123 GN=lacZ PE=3 SV=1
A9MQ82	1.89e-11	23	426	52	462	Beta-galactosidase OS=Salmonella arizonae (strain ATCC BAA-731 / CDC346-86 / RSK2980) OX=41514 GN=lacZ PE=3 SV=2

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.003209	0.924627	0.070532	0.000586	0.000509	0.000500

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003992_00928.