CAZyme Information: MGYG000003994_00845

Basic Information

• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; UBA11471; UBA11471
• CAZyme ID: MGYG000003994_00845
• CAZy Family: PL10
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
364		41934.73	6.8509

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003994	2451435	MAG	United Kingdom	Europe

• Gene Location: Start: 14643; End: 15737 Strand: +

Full Sequence      

MKKKILGVCFCLLSLAATAQTAQDLQKLSWKQIATKMPQEWYGTPEAKAIADKLLLYQTD
LGGFPKNIAFHKEIRQDVIDKMKETGIGATIDNNATINEMRFLTSMYAQTHDQRYRDAFF
KALDYIYLSQYDNGGWPQFYPYRKGKSVAYSRDITYNDGAIVNVLKLLYAISDDDKPYVV
FNFTPEEKAKALKAYQKGIQCILDTQIRNKKGELTVWCAQHDPETLKPANARAYELASYS
GDESADIVLLLMKVEDPSPEVIAAVKGAVKWFDEHKITDTKYVRYRDENNKWVARVEYEK
GATPLWARFYDLETEQPFFCDRDGIKRATLAEVGPERRGGYSWYNDEGNEVLEKYAEWIK
KIEK

Enzyme Prediction     

No EC number prediction in MGYG000003994_00845.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
PL10	58	350	1.3e-107	0.9930555555555556

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam09492	Pec_lyase	2.57e-126	58	352	1	289	Pectic acid lyase. Members of this family are isozymes of pectate lyase (EC:4.2.2.2), also called polygalacturonic transeliminase and alpha-1,4-D-endopolygalacturonic acid lyase.
TIGR02474	pec_lyase	3.58e-110	58	352	1	290	pectate lyase, PelA/Pel-15E family. Members of this family are isozymes of pectate lyase (EC 4.2.2.2), also called polygalacturonic transeliminase and alpha-1,4-D-endopolygalacturonic acid lyase. [Energy metabolism, Biosynthesis and degradation of polysaccharides]

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QEC53563.1	1.59e-120	17	358	22	365
SOE21140.1	3.64e-120	22	363	18	358
AKP52260.1	4.00e-113	22	361	31	370
AEL26628.1	3.69e-111	22	361	31	370
QUT78007.1	7.57e-111	1	364	1	364

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
1R76_A	1.67e-58	38	361	74	407	ChainA, pectate lyase [Niveispirillum irakense]
1GXM_A	3.26e-51	51	352	37	323	Family10 polysaccharide lyase from Cellvibrio cellulosa [Cellvibrio japonicus],1GXM_B Family 10 polysaccharide lyase from Cellvibrio cellulosa [Cellvibrio japonicus],1GXN_A Family 10 polysaccharide lyase from Cellvibrio cellulosa [Cellvibrio japonicus]
1GXO_A	4.93e-50	51	352	37	323	MutantD189A of Family 10 polysaccharide lyase from Cellvibrio cellulosa in complex with trigalaturonic acid [Cellvibrio japonicus]

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000471	0.998652	0.000284	0.000193	0.000195	0.000182

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003994_00845.