CAZyme Information: MGYG000003994_01254

Basic Information

• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; UBA11471; UBA11471
• CAZyme ID: MGYG000003994_01254
• CAZy Family: GH88
• CAZyme Description: Unsaturated chondroitin disaccharide hydrolase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
416	MGYG000003994_45|CGC1	47251.29	5.5185

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003994	2451435	MAG	United Kingdom	Europe

• Gene Location: Start: 3483; End: 4733 Strand: +

Full Sequence      

MKKKWLLTLVAMPLLAAACTGRGPGADGEKLIEESVLLAATQAENMLQEVGAPDKRNYPR
TLTAEGSLRTTSIRDWTSGFFPGSLWYLYELTGDEKWKTRAEEWTASLEELKTFTGHHDI
GFMMYCSYGNAVRLAPRENYEDILVRNAESLCSRYSDKVKAIKSWNSRKSWDGNEWRYPV
IVDNMMNLELLFYAYRVTGEKRFYDIAVAHANTTLKNHFRPDNGSYHVVSYDPEMGEVCF
RQTCQGYSDNSTWSRGQAWAVYGYTMMYRETRDTTYLGAACRFADYFISHLPQDMIPVWD
FNAGEAGYVPAENSYACRYPEVSTLKDASAAAIVASALFELADLSANAEYRRVAVAMLES
LSSSEYRAAPGENGNFVIRHCTGGLPQKTEIDVPLVYADYYYLEALVRYKKWLEGK

Enzyme Prediction     

EC	3.2.1.-

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH88	70	409	2.8e-126	0.9908814589665653

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam07470	Glyco_hydro_88	1.29e-15	66	270	19	207	Glycosyl Hydrolase Family 88. Unsaturated glucuronyl hydrolase catalyzes the hydrolytic release of unsaturated glucuronic acids from oligosaccharides (EC:3.2.1.-) produced by the reactions of polysaccharide lyases.
COG1331	YyaL	0.005	137	363	370	569	Uncharacterized conserved protein YyaL, SSP411 family, contains thoiredoxin and six-hairpin glycosidase-like domains [General function prediction only].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QIK55008.1	1.22e-184	3	410	5	410
QIK60440.1	1.22e-184	3	410	5	410
QIK58915.1	5.23e-174	27	410	29	411
QIK53447.1	1.05e-173	27	410	29	411
AXY78437.1	5.78e-147	26	416	22	413

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3WIW_A	2.01e-100	3	409	2	388	Crystalstructure of unsaturated glucuronyl hydrolase specific for heparin [Pedobacter heparinus DSM 2366]
2ZZR_A	4.86e-47	32	412	28	393	Crystalstructure of unsaturated glucuronyl hydrolase from Streptcoccus agalactiae [Streptococcus agalactiae]
3ANJ_A	4.97e-47	32	412	29	394	Crystalstructure of unsaturated glucuronyl hydrolase from Streptcoccus agalactiae [Streptococcus agalactiae serogroup III]
3WUX_A	1.35e-46	32	412	29	394	Crystalstructure of unsaturated glucuronyl hydrolase mutant D115N/K370S from Streptococcus agalactiae [Streptococcus agalactiae NEM316]
3ANI_A	2.63e-46	32	412	29	394	Crystalstructure of unsaturated glucuronyl hydrolase mutant D175N from Streptcoccus agalactiae [Streptococcus agalactiae serogroup III],3ANK_A Crystal structure of unsaturated glucuronyl hydrolase mutant D175N from Streptcoccus agalactiae complexed with dGlcA-GalNAc6S [Streptococcus agalactiae serogroup III]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
T2KLZ3	5.58e-105	2	408	3	393	Unsaturated glucuronyl hydrolase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_21900 PE=1 SV=1
Q8DR77	6.59e-48	55	412	46	392	Unsaturated chondroitin disaccharide hydrolase OS=Streptococcus pneumoniae (strain ATCC BAA-255 / R6) OX=171101 GN=ugl PE=1 SV=1
Q8E372	2.72e-46	32	412	29	394	Unsaturated chondroitin disaccharide hydrolase OS=Streptococcus agalactiae serotype III (strain NEM316) OX=211110 GN=gbs1889 PE=1 SV=1
Q9A0T3	2.05e-45	55	412	49	395	Unsaturated chondroitin disaccharide hydrolase OS=Streptococcus pyogenes serotype M1 OX=301447 GN=ugl PE=1 SV=1
Q9RC92	2.54e-44	75	415	41	370	Unsaturated glucuronyl hydrolase OS=Bacillus sp. (strain GL1) OX=84635 GN=ugl PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as LIPO

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000000	0.000000	1.000049	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003994_01254.