CAZyme Information: MGYG000003994_01592

Basic Information

• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; UBA11471; UBA11471
• CAZyme ID: MGYG000003994_01592
• CAZy Family: GT51
• CAZyme Description: Monofunctional biosynthetic peptidoglycan transglycosylase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
191	MGYG000003994_74|CGC1	21361.96	10.2426

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003994	2451435	MAG	United Kingdom	Europe

• Gene Location: Start: 6102; End: 6677 Strand: +

Full Sequence      

MSTLSHQKEKNTSSPDKKAGKKDITRIIVIVLWVLFVAILVGVGLLFNAISKGRIGYMPP
IEELQNPKDKLASEIYSADMVPIGRFYLEQGNRISIDYDQISQPMIDALLATEDVRFYEH
SGVDFKALLRAVVKRGILRQKSAGGGSTITQQLAKLLYSPTAGNVKERLFQKPIEWVIAC
SWSISTPRKRL

Enzyme Prediction     

No EC number prediction in MGYG000003994_01592.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT51	83	181	1.9e-26	0.5141242937853108

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam00912	Transgly	1.08e-29	82	179	4	94	Transglycosylase. The penicillin-binding proteins are bifunctional proteins consisting of transglycosylase and transpeptidase in the N- and C-terminus respectively. The transglycosylase domain catalyzes the polymerization of murein glycan chains.
COG5009	MrcA	5.68e-29	26	158	3	131	Membrane carboxypeptidase/penicillin-binding protein [Cell wall/membrane/envelope biogenesis].
COG0744	MrcB	5.97e-29	14	179	2	158	Membrane carboxypeptidase (penicillin-binding protein) [Cell wall/membrane/envelope biogenesis].
COG4953	PbpC	1.08e-15	30	158	3	122	Membrane carboxypeptidase/penicillin-binding protein PbpC [Cell wall/membrane/envelope biogenesis].
PRK00056	mtgA	3.22e-15	96	158	63	124	monofunctional biosynthetic peptidoglycan transglycosylase; Provisional

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BCI64612.1	1.78e-58	32	179	22	169
AHF12985.1	1.64e-56	32	179	20	167
QUT47776.1	1.02e-53	24	179	5	160
QQY44148.1	3.43e-52	31	179	8	156
QUT57921.1	3.43e-52	31	179	8	156

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5U2G_A	1.78e-10	58	155	7	101	2.6Angstrom Resolution Crystal Structure of Penicillin-Binding Protein 1A from Haemophilus influenzae [Haemophilus influenzae Rd KW20],5U2G_B 2.6 Angstrom Resolution Crystal Structure of Penicillin-Binding Protein 1A from Haemophilus influenzae [Haemophilus influenzae Rd KW20]
3UDF_A	4.31e-10	74	169	22	114	ChainA, Penicillin-binding protein 1a [Acinetobacter baumannii],3UDF_B Chain B, Penicillin-binding protein 1a [Acinetobacter baumannii],3UDI_A Chain A, Penicillin-binding protein 1a [Acinetobacter baumannii],3UDI_B Chain B, Penicillin-binding protein 1a [Acinetobacter baumannii],3UDX_A Chain A, Penicillin-binding protein 1a [Acinetobacter baumannii],3UDX_B Chain B, Penicillin-binding protein 1a [Acinetobacter baumannii],3UE0_A Chain A, Penicillin-binding protein 1a [Acinetobacter baumannii],3UE0_B Chain B, Penicillin-binding protein 1a [Acinetobacter baumannii],3UE1_A Chain A, Penicillin-binding protein 1a [Acinetobacter baumannii],3UE1_B Chain B, Penicillin-binding protein 1a [Acinetobacter baumannii]
3NB6_A	2.17e-09	82	175	7	96	Crystalstructure of Aquifex aeolicus peptidoglycan glycosyltransferase in complex with Methylphosphoryl Neryl Moenomycin [Aquifex aeolicus]
2OQO_A	5.66e-09	82	175	7	96	Crystalstructure of a peptidoglycan glycosyltransferase from a class A PBP: insight into bacterial cell wall synthesis [Aquifex aeolicus VF5],3D3H_A Crystal structure of a complex of the peptidoglycan glycosyltransferase domain from Aquifex aeolicus and neryl moenomycin A [Aquifex aeolicus],3NB7_A Crystal structure of Aquifex Aeolicus Peptidoglycan Glycosyltransferase in complex with Decarboxylated Neryl Moenomycin [Aquifex aeolicus]
4OON_A	9.04e-09	61	178	9	118	Crystalstructure of PBP1a in complex with compound 17 ((4Z,8S,11E,14S)-5-(2-amino-1,3-thiazol-4-yl)-14-(5,6-dihydroxy-1,3-dioxo-1,3-dihydro-2H-isoindol-2-yl)-8-formyl-2-methyl-6-oxo-3,10-dioxa-4,7,11-triazatetradeca-4,11-diene-2,12,14-tricarboxylic acid) [Pseudomonas aeruginosa PAO1]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q87AW7	2.59e-13	32	169	12	146	Penicillin-binding protein 1A OS=Xylella fastidiosa (strain Temecula1 / ATCC 700964) OX=183190 GN=mrcA PE=3 SV=1
Q9PGD4	1.19e-12	32	169	12	146	Penicillin-binding protein 1A OS=Xylella fastidiosa (strain 9a5c) OX=160492 GN=mrcA PE=3 SV=2
Q0AIQ0	1.21e-11	96	178	78	159	Biosynthetic peptidoglycan transglycosylase OS=Nitrosomonas eutropha (strain DSM 101675 / C91 / Nm57) OX=335283 GN=mtgA PE=3 SV=1
O87626	3.40e-11	40	158	18	132	Penicillin-binding protein 1A OS=Neisseria flavescens OX=484 GN=mrcA PE=3 SV=1
P02918	4.66e-11	58	155	33	127	Penicillin-binding protein 1A OS=Escherichia coli (strain K12) OX=83333 GN=mrcA PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.999989	0.000062	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

start	end
27	49