CAZyme Information: MGYG000003994_02017

Basic Information

• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; UBA11471; UBA11471
• CAZyme ID: MGYG000003994_02017
• CAZy Family: PL10
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
328		37405.34	8.645

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003994	2451435	MAG	United Kingdom	Europe

• Gene Location: Start: 1179; End: 2165 Strand: +

Full Sequence      

MSAEWYGTEQAVNIADTVLHYQTAIGGWPKNVGFHKHVNQEEMARVRKSGIGATFDNGAT
LSEMRFLAKVYTYRKDERYRNAFLKAFNYILEAQYDNGGWPQFYPVRKGRSVSYSGQVTY
NDNAYVNVMNMLRDIFTDAPCFRSLALGDEVRAQAKASFDKGVDCILKSQILIDGKLTAW
CAQHDSVTLQPVKARAYELPSISGAESANIVLLLMSIPHPSDDVVKAVKSAVKWFDEHKI
ADMRYERFRDKNGKRDSLLVPEEGSMVWGRFYDLETHKPYFSDRDGIKKNSLEEIGQERR
GGYSWYCNNPGKVLKTYPKWLEANGLKD

Enzyme Prediction     

No EC number prediction in MGYG000003994_02017.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
PL10	22	312	2.7e-112	0.9930555555555556

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam09492	Pec_lyase	3.56e-143	22	314	1	289	Pectic acid lyase. Members of this family are isozymes of pectate lyase (EC:4.2.2.2), also called polygalacturonic transeliminase and alpha-1,4-D-endopolygalacturonic acid lyase.
TIGR02474	pec_lyase	2.05e-127	22	314	1	290	pectate lyase, PelA/Pel-15E family. Members of this family are isozymes of pectate lyase (EC 4.2.2.2), also called polygalacturonic transeliminase and alpha-1,4-D-endopolygalacturonic acid lyase. [Energy metabolism, Biosynthesis and degradation of polysaccharides]

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AEL26628.1	3.09e-128	1	326	46	373
AKP52260.1	1.44e-126	1	326	46	373
SOE21140.1	2.58e-123	1	324	33	357
QEC53563.1	8.56e-121	1	328	47	374
ALJ01761.1	3.10e-116	1	327	47	376

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
1R76_A	1.52e-66	3	324	75	408	ChainA, pectate lyase [Niveispirillum irakense]
1GXM_A	1.66e-65	2	319	21	328	Family10 polysaccharide lyase from Cellvibrio cellulosa [Cellvibrio japonicus],1GXM_B Family 10 polysaccharide lyase from Cellvibrio cellulosa [Cellvibrio japonicus],1GXN_A Family 10 polysaccharide lyase from Cellvibrio cellulosa [Cellvibrio japonicus]
1GXO_A	2.61e-64	2	319	21	328	MutantD189A of Family 10 polysaccharide lyase from Cellvibrio cellulosa in complex with trigalaturonic acid [Cellvibrio japonicus]

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000014	0.000034	0.000002	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003994_02017.