CAZyme Information: MGYG000003996_00066

Basic Information

• Species: UMGS2055 sp900557635
• Lineage: Bacteria; Firmicutes_A; Clostridia; Oscillospirales; CAG-272; UMGS2055; UMGS2055 sp900557635
• CAZyme ID: MGYG000003996_00066
• CAZy Family: GH63
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
503		58088.25	4.91

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003996	1767468	MAG	United Kingdom	Europe

• Gene Location: Start: 4984; End: 6495 Strand: -

Full Sequence      

MELQKVDNDLTYVDSPFVAENVFRTMEAEDAPLPTYEENRDRLPKPFWDGHDDAIACYDY
AWQTAFGNLRKPNAEAGFVSNFIDTAFNGFLFMWDSSFIVMFGKYGSKIFNFQKTLDNMY
SHQHRDGYICREICEFERGEHFNRFDPAGTGPNIMPWSEWESYCQTGDKERLAKIYPPLL
AYHLWLKKHHTWRDGTYWNTGWGCGMDNQPRLPAGYHEAFDHGHMVWMDTCVQQVLSAKI
LLSMAEVLGRDDKEALDELRAEVAHLTTVINEKLWCEEDAFYYDLYRDDTLNHVKTVGAY
WALLADIIPAERLDRFVAHLDNPAEFKRTHRVPTLSADSPDYRPGGDYWKGSVWAPTNYM
VLKGLEKNGYEKLAYEIACNNLENVVQVFRDTGTLWENYAPEAVTRGSWSKDKFVGWSGL
FPISIMFEYVFGIRPHAGKNTIVWHVNRTERHGVMQYPLGDADVDLICEARKSADEKPQI
TVHSTAPVTVEVHWGDNVEIIEA

Enzyme Prediction     

No EC number prediction in MGYG000003996_00066.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH63	87	418	6.4e-34	0.3543859649122807

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK10137	PRK10137	9.63e-15	137	410	404	772	alpha-glucosidase; Provisional
pfam03200	Glyco_hydro_63	2.67e-14	172	428	188	494	Glycosyl hydrolase family 63 C-terminal domain. This is a family of eukaryotic enzymes belonging to glycosyl hydrolase family 63. They catalyze the specific cleavage of the non-reducing terminal glucose residue from Glc(3)Man(9)GlcNAc(2). Mannosyl oligosaccharide glucosidase EC:3.2.1.106 is the first enzyme in the N-linked oligosaccharide processing pathway. This family represents the C-terminal catalytic domain.
COG3408	GDB1	4.98e-11	9	442	208	619	Glycogen debranching enzyme (alpha-1,6-glucosidase) [Carbohydrate transport and metabolism].
pfam01204	Trehalase	2.67e-09	239	399	316	473	Trehalase. Trehalase (EC:3.2.1.28) is known to recycle trehalose to glucose. Trehalose is a physiological hallmark of heat-shock response in yeast and protects of proteins and membranes against a variety of stresses. This family is found in conjunction with pfam07492 in fungi.
pfam17389	Bac_rhamnosid6H	2.78e-07	154	320	105	251	Bacterial alpha-L-rhamnosidase 6 hairpin glycosidase domain. This family consists of bacterial rhamnosidase A and B enzymes. L-Rhamnose is abundant in biomass as a common constituent of glycolipids and glycosides, such as plant pigments, pectic polysaccharides, gums or biosurfactants. Some rhamnosides are important bioactive compounds. For example, terpenyl glycosides, the glycosidic precursor of aromatic terpenoids, act as important flavouring substances in grapes. Other rhamnosides act as cytotoxic rhamnosylated terpenoids, as signal substances in plants or play a role in the antigenicity of pathogenic bacteria.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QIN83484.1	2.74e-210	11	494	10	500
AIQ57834.1	7.50e-210	12	502	7	496
QHT63246.1	2.04e-206	2	503	20	523
QHT63247.1	5.16e-187	12	499	28	517
QBJ17752.1	8.69e-178	11	495	37	519

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
7T66_A	8.19e-10	152	420	541	806	ChainA, Chaetomium alpha glucosidase [Thermochaetoides thermophila DSM 1495],7T66_B Chain B, Chaetomium alpha glucosidase [Thermochaetoides thermophila DSM 1495],7T68_A Chain A, Chaetomium alpha glucosidase [Thermochaetoides thermophila DSM 1495],7T68_B Chain B, Chaetomium alpha glucosidase [Thermochaetoides thermophila DSM 1495],7T6W_A Chain A, Chaetomium alpha glucosidase [Thermochaetoides thermophila DSM 1495],7T6W_B Chain B, Chaetomium alpha glucosidase [Thermochaetoides thermophila DSM 1495],7T8V_A Chain A, Chaetomium alpha glucosidase [Thermochaetoides thermophila DSM 1495],7T8V_B Chain B, Chaetomium alpha glucosidase [Thermochaetoides thermophila DSM 1495]
5MHF_A	2.25e-08	205	445	523	795	Murineendoplasmic reticulum alpha-glucosidase I with N-9'-methoxynonyl-1-deoxynojirimycin [Mus musculus],5MHF_B Murine endoplasmic reticulum alpha-glucosidase I with N-9'-methoxynonyl-1-deoxynojirimycin [Mus musculus],5MHF_C Murine endoplasmic reticulum alpha-glucosidase I with N-9'-methoxynonyl-1-deoxynojirimycin [Mus musculus],5MHF_D Murine endoplasmic reticulum alpha-glucosidase I with N-9'-methoxynonyl-1-deoxynojirimycin [Mus musculus]
3W7S_A	2.92e-08	137	401	377	731	Escherichiacoli K12 YgjK complexed with glucose [Escherichia coli K-12],3W7S_B Escherichia coli K12 YgjK complexed with glucose [Escherichia coli K-12],3W7T_A Escherichia coli K12 YgjK complexed with mannose [Escherichia coli K-12],3W7T_B Escherichia coli K12 YgjK complexed with mannose [Escherichia coli K-12],3W7U_A Escherichia coli K12 YgjK complexed with galactose [Escherichia coli K-12],3W7U_B Escherichia coli K12 YgjK complexed with galactose [Escherichia coli K-12]
3W7X_A	2.92e-08	137	401	377	731	Crystalstructure of E. coli YgjK D324N complexed with melibiose [Escherichia coli K-12],3W7X_B Crystal structure of E. coli YgjK D324N complexed with melibiose [Escherichia coli K-12],5CA3_A Crystal structure of the glycosynthase mutant D324N of Escherichia coli GH63 glycosidase in complex with glucose and lactose [Escherichia coli K-12],5CA3_B Crystal structure of the glycosynthase mutant D324N of Escherichia coli GH63 glycosidase in complex with glucose and lactose [Escherichia coli K-12]
3W7W_A	1.54e-07	137	401	377	731	Crystalstructure of E. coli YgjK E727A complexed with 2-O-alpha-D-glucopyranosyl-alpha-D-galactopyranose [Escherichia coli K-12],3W7W_B Crystal structure of E. coli YgjK E727A complexed with 2-O-alpha-D-glucopyranosyl-alpha-D-galactopyranose [Escherichia coli K-12],5GW7_A Crystal structure of the glycosynthase mutant E727A of Escherichia coli GH63 glycosidase in complex with glucose and lactose [Escherichia coli K-12],5GW7_B Crystal structure of the glycosynthase mutant E727A of Escherichia coli GH63 glycosidase in complex with glucose and lactose [Escherichia coli K-12]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P94250	9.23e-36	96	472	62	433	Uncharacterized protein BB_0381 OS=Borreliella burgdorferi (strain ATCC 35210 / DSM 4680 / CIP 102532 / B31) OX=224326 GN=BB_0381 PE=4 SV=2
O14255	3.43e-13	127	428	482	806	Probable mannosyl-oligosaccharide glucosidase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPAC6G10.09 PE=3 SV=1
Q19426	1.77e-08	152	420	490	785	Mannosyl-oligosaccharide glucosidase OS=Caenorhabditis elegans OX=6239 GN=mogs-1 PE=1 SV=2
Q80UM7	9.52e-08	168	429	527	834	Mannosyl-oligosaccharide glucosidase OS=Mus musculus OX=10090 GN=Mogs PE=1 SV=1
P42592	1.62e-07	137	401	400	754	Glucosidase YgjK OS=Escherichia coli (strain K12) OX=83333 GN=ygjK PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000033	0.000001	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003996_00066.