CAZyme Information: MGYG000003997_00830

Basic Information

• Species: HGM12650 sp900761725
• Lineage: Bacteria; Firmicutes_A; Clostridia; Oscillospirales; CAG-272; HGM12650; HGM12650 sp900761725
• CAZyme ID: MGYG000003997_00830
• CAZy Family: GT5
• CAZyme Description: Glycogen synthase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
490	MGYG000003997_5|CGC1	55779.15	6.8916

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003997	1773221	MAG	United Kingdom	Europe

• Gene Location: Start: 119312; End: 120784 Strand: +

Full Sequence      

MAVTGKIKIKKILFVGAEAMPFAATGGLGDVLGSLPAALKAEYGERADIRVVMPLYSMVS
NSWREKMTDVAIFDVPLAWRRQYCGIKQLEKDGVIFYFIDNEYYFKRDKLYGSYDDGERF
AYFCMAVMEMLPKIDFYPEVLHAHDWQAALSVVYLNMKYRQIRGYENIRTVFTIHNIEYQ
GKYDFSILGDVFSLGEDAHSLMEYDGCINLMKAAIECADIVSTVSPRYAEEIRTPEYAHG
LDSVLNRNSFKLRGILNGIDYAYYNPSEDPVLAEKYDATHQKGKYADKKLLQNDLGLPED
PDIPVMAIISRLAAHKGIDLVTQIVYNFINDNKVQLIVLGTGEERYESFFKNLENAFPGK
VRALIRYDRDLSRRIYAAADIFIMPSKSEPCGLSQMIASRYGAIPVVRETGGLYDSIKGY
WECDGKIMGNGFTFANYSSYELLDRMNAAVGLWHDAKKRRALVKKIMNTDFSWRASAKSY
IGMYAELCKK

Enzyme Prediction     

No EC number prediction in MGYG000003997_00830.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT5	11	485	4.1e-166	0.9957627118644068

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd03791	GT5_Glycogen_synthase_DULL1-like	0.0	11	486	1	474	Glycogen synthase GlgA and similar proteins. This family is most closely related to the GT5 family of glycosyltransferases. Glycogen synthase (EC:2.4.1.21) catalyzes the formation and elongation of the alpha-1,4-glucose backbone using ADP-glucose, the second and key step of glycogen biosynthesis. This family includes starch synthases of plants, such as DULL1 in Zea mays and glycogen synthases of various organisms.
PRK00654	glgA	0.0	11	490	2	466	glycogen synthase GlgA.
TIGR02095	glgA	0.0	11	487	2	473	glycogen/starch synthase, ADP-glucose type. This family consists of glycogen (or starch) synthases that use ADP-glucose (EC 2.4.1.21), rather than UDP-glucose (EC 2.4.1.11) as in animals, as the glucose donor. This enzyme is found in bacteria and plants. Whether the name given is glycogen synthase or starch synthase depends on context, and therefore on substrate. [Energy metabolism, Biosynthesis and degradation of polysaccharides]
COG0297	GlgA	3.68e-173	11	487	2	478	Glycogen synthase [Carbohydrate transport and metabolism].
PRK14099	PRK14099	1.04e-104	11	487	5	479	glycogen synthase GlgA.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CAB1243454.1	8.24e-168	11	490	2	474
QEY34691.1	5.20e-164	11	490	2	474
BCI60006.1	7.13e-164	11	490	2	475
QOX62809.1	9.64e-159	12	489	3	474
ARP51332.1	1.37e-158	11	490	2	474

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6GNE_A	3.58e-79	12	484	12	494	Catalyticdomain of Starch Synthase IV from Arabidopsis thaliana bound to ADP and acarbose [Arabidopsis thaliana],6GNE_B Catalytic domain of Starch Synthase IV from Arabidopsis thaliana bound to ADP and acarbose [Arabidopsis thaliana]
3D1J_A	1.02e-76	11	487	2	476	ChainA, Glycogen synthase [Escherichia coli]
2QZS_A	1.26e-76	11	487	2	476	CrystalStructure of Wild-type E.coli GS in complex with ADP and Glucose(wtGSb) [Escherichia coli],2R4T_A Crystal Structure of Wild-type E.coli GS in Complex with ADP and Glucose(wtGSc) [Escherichia coli],2R4U_A Crystal Structure of Wild-type E.coli GS in complex with ADP and Glucose(wtGSd) [Escherichia coli],3GUH_A Crystal Structure of Wild-type E.coli GS in complex with ADP and DGM [Escherichia coli K-12]
3COP_A	9.69e-76	11	487	2	476	ChainA, Glycogen synthase [Escherichia coli],3CX4_A Chain A, Glycogen synthase [Escherichia coli]
3VUE_A	1.88e-68	12	480	12	504	CrystalStructure of Rice Granule bound Starch Synthase I Catalytic Domain [Oryza sativa Japonica Group],3VUF_A Crystal Structure of Rice Granule bound Starch Synthase I Catalytic Domain in Complex with ADP [Oryza sativa Japonica Group]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
A4IS20	1.93e-154	11	490	2	477	Glycogen synthase OS=Geobacillus thermodenitrificans (strain NG80-2) OX=420246 GN=glgA PE=3 SV=1
O08328	7.78e-154	11	490	2	477	Glycogen synthase OS=Geobacillus stearothermophilus OX=1422 GN=glgA PE=3 SV=1
B7GK04	6.94e-152	11	487	2	474	Glycogen synthase OS=Anoxybacillus flavithermus (strain DSM 21510 / WK1) OX=491915 GN=glgA PE=3 SV=1
B2V049	5.52e-147	11	487	2	475	Glycogen synthase OS=Clostridium botulinum (strain Alaska E43 / Type E3) OX=508767 GN=glgA PE=3 SV=1
B2TR28	1.57e-146	11	487	2	475	Glycogen synthase OS=Clostridium botulinum (strain Eklund 17B / Type B) OX=935198 GN=glgA PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000044	0.000001	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003997_00830.