CAZyme Information: MGYG000003999_00922

Basic Information

• Lineage: Bacteria; Proteobacteria; Gammaproteobacteria; Burkholderiales; Burkholderiaceae; CAG-521
• CAZyme ID: MGYG000003999_00922
• CAZy Family: GT4
• CAZyme Description: Lipopolysaccharide core biosynthesis protein RfaG

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
380		43720.91	9.0162

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000003999	1640178	MAG	United Kingdom	Europe

• Gene Location: Start: 48302; End: 49444 Strand: -

Full Sequence      

MALSVYENFKSMKIACCLYKFFPYGGLQRDFLRIAEVLVKRGHEVRVYTREWNADTTPKN
MELILVPAKGLSNNAKNVSFFNWVQNHLKSHPVDRVVGFNKMPDLDVYYGADVCFAEKTA
DKGFFYKLTSRYKHYLEYEKQTVGKGLKTKLMIITPNQKRDFQKHYQTEDERFYLLPPGI
SPDRKYSNFRPNAREDFRRKNHLTEEDFLLLQIGSDFKRKGVDRSIEALASLPEELRKHT
FFYVIGLDKPEKFSELAASLKVSQQVRFWGGRNDVPDFIAGADLFLHPARSENTGTAILE
ALVGGLPQIVTDVCGYAPYVEKAQSGLVLDSPYDQKQFNNYLQKALNLTQLDKWRNNAKS
FADSEDLYSLPEKAADIILG

Enzyme Prediction     

No EC number prediction in MGYG000003999_00922.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT4	201	353	2e-23	0.95625

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd03801	GT4_PimA-like	7.58e-40	13	379	1	362	phosphatidyl-myo-inositol mannosyltransferase. This family is most closely related to the GT4 family of glycosyltransferases and named after PimA in Propionibacterium freudenreichii, which is involved in the biosynthesis of phosphatidyl-myo-inositol mannosides (PIM) which are early precursors in the biosynthesis of lipomannans (LM) and lipoarabinomannans (LAM), and catalyzes the addition of a mannosyl residue from GDP-D-mannose (GDP-Man) to the position 2 of the carrier lipid phosphatidyl-myo-inositol (PI) to generate a phosphatidyl-myo-inositol bearing an alpha-1,2-linked mannose residue (PIM1). Glycosyltransferases catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds. The acceptor molecule can be a lipid, a protein, a heterocyclic compound, or another carbohydrate residue. This group of glycosyltransferases is most closely related to the previously defined glycosyltransferase family 1 (GT1). The members of this family may transfer UDP, ADP, GDP, or CMP linked sugars. The diverse enzymatic activities among members of this family reflect a wide range of biological functions. The protein structure available for this family has the GTB topology, one of the two protein topologies observed for nucleotide-sugar-dependent glycosyltransferases. GTB proteins have distinct N- and C- terminal domains each containing a typical Rossmann fold. The two domains have high structural homology despite minimal sequence homology. The large cleft that separates the two domains includes the catalytic center and permits a high degree of flexibility. The members of this family are found mainly in certain bacteria and archaea.
COG0438	RfaB	9.17e-28	12	379	1	371	Glycosyltransferase involved in cell wall bisynthesis [Cell wall/membrane/envelope biogenesis].
pfam00534	Glycos_transf_1	3.05e-27	206	361	1	158	Glycosyl transferases group 1. Mutations in this domain of PIGA lead to disease (Paroxysmal Nocturnal haemoglobinuria). Members of this family transfer activated sugars to a variety of substrates, including glycogen, Fructose-6-phosphate and lipopolysaccharides. Members of this family transfer UDP, ADP, GDP or CMP linked sugars. The eukaryotic glycogen synthases may be distant members of this family.
cd03811	GT4_GT28_WabH-like	8.70e-22	13	316	1	297	family 4 and family 28 glycosyltransferases similar to Klebsiella WabH. This family is most closely related to the GT1 family of glycosyltransferases. WabH in Klebsiella pneumoniae has been shown to transfer a GlcNAc residue from UDP-GlcNAc onto the acceptor GalUA residue in the cellular outer core.
cd03800	GT4_sucrose_synthase	1.59e-20	152	358	166	379	sucrose-phosphate synthase and similar proteins. This family is most closely related to the GT4 family of glycosyltransferases. The sucrose-phosphate synthases in this family may be unique to plants and photosynthetic bacteria. This enzyme catalyzes the synthesis of sucrose 6-phosphate from fructose 6-phosphate and uridine 5'-diphosphate-glucose, a key regulatory step of sucrose metabolism. The activity of this enzyme is regulated by phosphorylation and moderated by the concentration of various metabolites and light.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QST28458.1	1.65e-146	12	380	1	370
BAT37073.1	1.65e-146	12	380	1	370
QST73663.1	1.65e-146	12	380	1	370
BAT45624.1	1.65e-146	12	380	1	370
QST37824.1	1.65e-146	12	380	1	370

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
2IW1_A	1.40e-146	12	380	1	370	CrystalStructure of WaaG, a glycosyltransferase involved in lipopolysaccharide biosynthesis [Escherichia coli str. K-12 substr. W3110]
2IV7_A	1.51e-143	14	380	3	370	CrystalStructure of WaaG, a glycosyltransferase involved in lipopolysaccharide biosynthesis [Escherichia coli str. K-12 substr. W3110]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P25740	7.67e-146	12	380	1	370	Lipopolysaccharide core biosynthesis protein RfaG OS=Escherichia coli (strain K12) OX=83333 GN=rfaG PE=1 SV=1
D7C367	3.72e-07	139	329	195	391	D-inositol 3-phosphate glycosyltransferase OS=Streptomyces bingchenggensis (strain BCW-1) OX=749414 GN=mshA PE=3 SV=1
A8LZG1	2.68e-06	246	330	295	381	D-inositol 3-phosphate glycosyltransferase OS=Salinispora arenicola (strain CNS-205) OX=391037 GN=mshA PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000054	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000003999_00922.