CAZyme Information: MGYG000004003_00401

Basic Information

• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Bacteroides
• CAZyme ID: MGYG000004003_00401
• CAZy Family: GH3
• CAZyme Description: Beta-N-acetylglucosaminidase/beta-glucosidase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
586	MGYG000004003_4|CGC1	66819.57	5.8475

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000004003	5653807	MAG	United Kingdom	Europe

• Gene Location: Start: 68207; End: 69967 Strand: +

Full Sequence      

MKNSFLIVTATLLVSVFFSCTKERVTAGSVNEVYEFQSVDSTWKLLTLREKIGQTMLMLP
DRKKELDLGDGSLEMYFKRYPVTGYFMGWKLFTGVPEEERVDFVRSSVEEYQKASELPLL
FQQDYESGVGLQGMTPFPKEMALGAANSPELAYKYGKSVALECRSLGINWVLHPVADLNM
NPLNPIVNTRSVSDDPEKAVCLLSEQIKGLQDNSVAATIKHFPGDGVDYRDQHLMTTVNS
LSEEMWKQYHGKVFAELIEKGVACIMPGHITLPFYQKEKINGYLPPATLSHELLSGLLKK
EMHFNGVVVSDAMTMAGFRGWYKNDLEGQVASFLAGVDILLWPSYEYMDTVEVRIQRGEI
PMERLDDAVRRVWAMKERFGLLNKNRELIRPVSTEEKAEIREAAKEITERSITLVRDEDH
KLPLSLEKDKKLLLVAVTPVAHKGNDRDFKRLQNLRDEFVKNGFEVDFRRNILYEDQGWQ
DNATEVYDKVIFLVARNTHTPFGPLQLWDDEAQSVWAANSMDKSKVIVISLGSPYIGNEY
FERVKTYINTYSNDTSTHSALLRILLGQLPFKGKSPVNLEHKLFTF

Enzyme Prediction     

No EC number prediction in MGYG000004003_00401.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH3	113	341	9.2e-57	0.9722222222222222

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG1472	BglX	1.09e-73	46	466	1	397	Periplasmic beta-glucosidase and related glycosidases [Carbohydrate transport and metabolism].
pfam00933	Glyco_hydro_3	7.70e-61	47	372	1	313	Glycosyl hydrolase family 3 N terminal domain.
PRK05337	PRK05337	3.82e-19	132	341	73	278	beta-hexosaminidase; Provisional
PRK15098	PRK15098	4.39e-13	39	435	38	416	beta-glucosidase BglX.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QRP59270.1	0.0	1	586	1	586
QQT78845.1	0.0	1	586	1	586
ASM64656.1	0.0	1	586	1	586
QUU06096.1	0.0	1	586	1	586
QNL39232.1	0.0	1	586	1	586

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5VQD_A	6.42e-63	104	578	72	557	Beta-glucosidephosphorylase BglX [unidentified],5VQE_A Beta-glucoside phosphorylase BglX bound to 2FGlc [unidentified]
6K5J_A	1.96e-53	44	579	9	531	Structureof a glycoside hydrolase family 3 beta-N-acetylglucosaminidase from Paenibacillus sp. str. FPU-7 [Paenibacillaceae]
3BMX_A	1.75e-49	6	436	7	459	Beta-N-hexosaminidase(YbbD) from Bacillus subtilis [Bacillus subtilis],3BMX_B Beta-N-hexosaminidase (YbbD) from Bacillus subtilis [Bacillus subtilis],3NVD_A Structure of YBBD in complex with pugnac [Bacillus subtilis],3NVD_B Structure of YBBD in complex with pugnac [Bacillus subtilis]
3LK6_A	1.04e-47	46	436	16	433	ChainA, Lipoprotein ybbD [Bacillus subtilis],3LK6_B Chain B, Lipoprotein ybbD [Bacillus subtilis],3LK6_C Chain C, Lipoprotein ybbD [Bacillus subtilis],3LK6_D Chain D, Lipoprotein ybbD [Bacillus subtilis]
4GYJ_A	1.57e-47	46	436	46	463	Crystalstructure of mutant (D318N) bacillus subtilis family 3 glycoside hydrolase (nagz) in complex with glcnac-murnac (space group P1) [Bacillus subtilis subsp. subtilis str. 168],4GYJ_B Crystal structure of mutant (D318N) bacillus subtilis family 3 glycoside hydrolase (nagz) in complex with glcnac-murnac (space group P1) [Bacillus subtilis subsp. subtilis str. 168],4GYK_A Crystal structure of mutant (D318N) bacillus subtilis family 3 glycoside hydrolase (nagz) in complex with glcnac-murnac (space group P1211) [Bacillus subtilis subsp. subtilis str. 168],4GYK_B Crystal structure of mutant (D318N) bacillus subtilis family 3 glycoside hydrolase (nagz) in complex with glcnac-murnac (space group P1211) [Bacillus subtilis subsp. subtilis str. 168]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q7WUL3	1.08e-57	106	578	72	554	Beta-N-acetylglucosaminidase/beta-glucosidase OS=Cellulomonas fimi OX=1708 GN=nag3 PE=1 SV=1
P40406	9.59e-49	6	436	7	459	Beta-hexosaminidase OS=Bacillus subtilis (strain 168) OX=224308 GN=nagZ PE=1 SV=1
P48823	1.58e-30	112	581	93	598	Beta-hexosaminidase A OS=Pseudoalteromonas piscicida OX=43662 GN=cht60 PE=1 SV=1
A7LXU3	4.10e-25	46	576	46	613	Beta-glucosidase BoGH3B OS=Bacteroides ovatus (strain ATCC 8483 / DSM 1896 / JCM 5824 / BCRC 10623 / CCUG 4943 / NCTC 11153) OX=411476 GN=BACOVA_02659 PE=1 SV=1
Q6LJ30	2.53e-20	104	341	42	272	Beta-hexosaminidase OS=Photobacterium profundum (strain SS9) OX=298386 GN=nagZ PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as LIPO

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000233	0.249597	0.749851	0.000106	0.000113	0.000103

TMHMM  Annotations     

There is no transmembrane helices in MGYG000004003_00401.