CAZyme Information: MGYG000004003_00468

Basic Information

• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Bacteroides
• CAZyme ID: MGYG000004003_00468
• CAZy Family: CBM32
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
936	MGYG000004003_5|CGC2	104023.35	4.9054

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000004003	5653807	MAG	United Kingdom	Europe

• Gene Location: Start: 34640; End: 37450 Strand: -

Full Sequence      

MKNYFLYVFISLFLFSLSSCKDDDDVVPVLELSSGNADFHKEAGSVVIDVKSLPADWTAS
VDVEGEQWCKAEPVNSGAGVKISVSSSPNKTVRSTSVIINNGKLDKKILVRQLGTDTDIL
VSPSSFTLTPVGGTVAFAVTTNLTEAELDVTYPSWIKKGTDTRAAMIEIPYQFTVGTYDG
SSARTEKIVIKDKKSDVSAEVTVTQNGLDGYTSGDTEGIADDVQLEVVRGEASTAHGGEG
IEKSFDSDMSTIYHSNYPFAEGVTSHYPVTLTYYFKENTEALDYLTYYPRTSGSNGNFGE
VEIQVSTEEHPAFESVTNETDFDFGSKGAVVSFSFNNTIQKPKAVRLIVKSGVNGHASCA
EMKFFARNPEGFDPLTLFTDVTCSELRSGITEETINACDYPFFKNIAYYMLKEKYPADFR
IADFKPYQHPDIQAAINKTSTYSLLDNPTGIFVKAGETLIVMVGETHGQHLSLRIQDMDA
PNADGFNSSVSYSLRTGINKIVSEKKGLIYVMYHVNGNLADYDEVKIHFASGSVNGYFDV
AKHTREQWSTLLNGAVDGYFDVVGKYAHLTFPVSKLKSTSSGKDLIDLFDDIVYKEQIFL
GLRKYNNNGGTGTDIDNRMFRNRMYFNVMYGENNYMYSTAYHTAYNVSTMSNLCNVDQMK
SNNWGPAHEVGHSNQTRPGLKWFGMTEVTNNICAMYIQKSYNAPSRLMTTSPNDGYSNYY
EHAMTLSFCNSDIFHAELGDVFDKLVPFWQLELYMDYVLGKTDFYKDVYEYVRINPDLST
DGERQIEFAYNCSKAAGLDLTDFFVKWGFLKPGTYKFNDTYTDGEVTVTETQINTLKNRI
KTLGYSSPQHKLEYLCDDNLEVYKKNATVVTGTATRSGSKLSMSGWQNVAVYKVCDNVGK
PIFVSPQSSFTVGGSLPNGFRVYAIAANGTETQVTF

Enzyme Prediction     

No EC number prediction in MGYG000004003_00468.

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam13402	Peptidase_M60	4.39e-50	532	808	1	268	Peptidase M60, enhancin and enhancin-like. This family of peptidases contains a zinc metallopeptidase motif (HEXXHX(8,28)E) and possesses mucinase activity. It includes the viral enhancins as well as enhancin-like peptidases from bacterial species. Enhancins are a class of metalloproteases found in some baculoviruses that enhance viral infection by degrading the peritrophic membrane (PM) of the insect midgut. Bacterial enhancins are found to be cytotoxic when compared to viral enhancin, however, suggesting that the bacterial enhancins do not enhance infection in the same way as viral enhancin. Bacterial enhancins may have evolved a distinct biochemical function. These bacterial domains are peptidases targetting host glycoproteins and thus probably play an important role in successful colonisation of both vertebrate mucosal surfaces and the invertebrate digestive tract by both mutualistic and pathogenic microbes. This family has been augmented by a merge with the sequences in the Enhancin Pfam family.
cd14948	BACON	4.08e-11	30	112	2	82	Bacteroidetes-Associated Carbohydrate-binding (putative) Often N-terminal (BACON) domain. The BACON domain is found in diverse domain architectures and accociated with a wide variety of domains, including carbohydrate-active enzymes and proteases. It was named for its suggested function of carbohydrate binding; the latter was inferred from domain architectures, sequence conservation, and phyletic distribution. However, recent experimental data suggest that its primary function in Bacteroides ovatus endo-xyloglucanase BoGH5A is to distance the catalytic module from the cell surface and confer additional mobility to the catalytic domain for attack of the polysaccharide. No evidence for a direct role in carbohydrate binding could be found in that case. The large majority of BACON domains are found in Bacteroidetes.
pfam17291	M60-like_N	4.44e-07	426	528	3	107	N-terminal domain of M60-like peptidases. This accessory domain has a jelly roll topology.
NF037974	SslE_AcfD_Zn_LP	7.07e-06	640	849	1152	1381	SslE/AcfD family lipoprotein zinc metalloprotease. Members of this family are surface lipoprotein zinc metalloproteases, from the family that includes accessory colonization factor AcfD from Vibrio cholerae, SslE (YghJ ) from E. coli (Secreted and Surface-associated Lipoprotein from E. coli), and VPA1376 from Vibrio parahaemolyticus. Each is about 1500 amino acids long, and SslE is a known substrate of a type II secretion system (T2SS). SslE is known to have mucinase activity.
cd14948	BACON	7.11e-06	119	205	2	82	Bacteroidetes-Associated Carbohydrate-binding (putative) Often N-terminal (BACON) domain. The BACON domain is found in diverse domain architectures and accociated with a wide variety of domains, including carbohydrate-active enzymes and proteases. It was named for its suggested function of carbohydrate binding; the latter was inferred from domain architectures, sequence conservation, and phyletic distribution. However, recent experimental data suggest that its primary function in Bacteroides ovatus endo-xyloglucanase BoGH5A is to distance the catalytic module from the cell surface and confer additional mobility to the catalytic domain for attack of the polysaccharide. No evidence for a direct role in carbohydrate binding could be found in that case. The large majority of BACON domains are found in Bacteroidetes.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QTO25368.1	1.39e-259	2	936	3	939
QRM71921.1	1.96e-259	2	936	3	939
QCT79445.1	3.14e-258	10	936	14	939
QRP89238.1	3.14e-258	10	936	14	939
QUU03487.1	4.44e-258	10	936	14	939

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5KD2_A	1.73e-52	375	929	32	602	BT_4244metallopeptidase from Bacteroides thetaiotaomicron [Bacteroides thetaiotaomicron VPI-5482]
7SCI_A	9.85e-50	366	857	2	487	ChainA, Peptidase M60 domain-containing protein [Akkermansia muciniphila ATCC BAA-835]
5KD5_A	8.79e-47	409	929	20	554	BT_4244metallopeptidase from Bacteroides thetaiotaomicron [Bacteroides thetaiotaomicron VPI-5482],5KD8_A BT_4244 metallopeptidase in complex with Tn antigen. [Bacteroides thetaiotaomicron VPI-5482]
7BLG_A	2.09e-30	213	367	12	162	ChainA, family 32 carbohydrate-binding module from Bacteroides thetaiotaomicron [Bacteroides thetaiotaomicron VPI-5482],7BLH_AAAA Chain AAAA, family 32 carbohydrate-binding module from Bacteroides thetaiotaomicron [Bacteroides thetaiotaomicron VPI-5482],7BLJ_A Chain A, family 32 carbohydrate-binding module from Bacteroides thetaiotaomicron [Bacteroides thetaiotaomicron VPI-5482],7BLK_A Chain A, family 32 carbohydrate-binding module from Bacteroides thetaiotaomicron [Bacteroides thetaiotaomicron VPI-5482]
5EV7_A	1.22e-26	448	808	45	379	Thecrystal structure of a functionally unknown conserved protein mutant from Bacillus anthracis str. Ames [Bacillus anthracis str. Ames]

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as LIPO

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000089	0.064630	0.935224	0.000026	0.000030	0.000024

TMHMM  Annotations     

There is no transmembrane helices in MGYG000004003_00468.