CAZyme Information: MGYG000004003_00555

Basic Information

• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Bacteroides
• CAZyme ID: MGYG000004003_00555
• CAZy Family: GH3
• CAZyme Description: Beta-glucosidase BoGH3A

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
748	MGYG000004003_6|CGC1	82651.85	6.7538

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000004003	5653807	MAG	United Kingdom	Europe

• Gene Location: Start: 47710; End: 49956 Strand: +

Full Sequence      

MKFKAMLLGLSVIATLSASAQKPVYLDTNKPIEERVKDALNRMTLEEKVKMLHAQSKFSS
AGVPRLGIPEVWATDGPHGIRPEVLWDEWNQAGWTNDSCIAYPALTCLSATWNPEMSHLY
GKSIGEEARYRKKDILLGPGVNIYRTPLNGRNFEYMGEDPYLSATMVVPYIKGVQENGVA
ACVKHYALNNQEFKRHTTNVHLSDRALYEIYLPAFKAAVQEGGAWSIMGSYNLYQGQHGC
HNKRLLKDILRDEWGFDGVVVSDWGGVHNTEQAIYNGLDLEFGSWTNGLSAGTRNAYDNY
YMAFPYLKLIKEGKVGTKELDEKVSNILRLIFRTSMDPHKPFGSLGSPEHGQAGREIAEE
GIVLLQNNGNVLPIDLNKAKKIAVIGENAIKMMTVGGGSSSLKVKYEISPLDGLKARASS
QAEIVYARGYVGDPTGEYNGVKTGQDLKDDRSENELLAEALQVAKDADYVIFFGGLNKSN
HQDCEDSDRASLGLPYAQDRVISELAKVNKNLIFVNISGNAVAMPWVNEVPAIVQGWFLG
SEAGTALASVLVGDANPSGKLPFTFPVKLDDVGAHKLGEYPGNKEELAKSKHRGDTINET
YHEDIFVGYRWADKEKIKPLFPFGHGLSYTTFVYGKPSADKKTMTTDDTISFTVNVKNTG
TREGQEVVQLYISDKKSSLPRPVKELKAFQKVRLSPGEEKAVTLTVDKKALSFFDDAKHE
WIAEPGKFEAVIGSSSRDIKGIVPFELK

Enzyme Prediction     

EC	3.2.1.21

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH3	61	281	2.4e-67	0.9814814814814815

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK15098	PRK15098	4.94e-123	1	740	1	758	beta-glucosidase BglX.
PLN03080	PLN03080	3.32e-73	5	716	9	753	Probable beta-xylosidase; Provisional
COG1472	BglX	2.98e-72	47	416	44	385	Periplasmic beta-glucosidase and related glycosidases [Carbohydrate transport and metabolism].
pfam01915	Glyco_hydro_3_C	1.32e-68	362	609	1	216	Glycosyl hydrolase family 3 C-terminal domain. This domain is involved in catalysis and may be involved in binding beta-glucan. This domain is found associated with pfam00933.
pfam00933	Glyco_hydro_3	1.39e-36	65	330	63	316	Glycosyl hydrolase family 3 N terminal domain.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QIU93709.1	0.0	1	748	1	748
ALJ48031.1	0.0	1	748	1	748
SCV07439.1	0.0	1	748	3	750
QRQ54905.1	0.0	1	748	3	750
QGT72794.1	0.0	1	748	3	750

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
7MS2_A	3.17e-153	36	739	5	660	ChainA, Thermostable beta-glucosidase B [Acetivibrio thermocellus AD2],7MS2_B Chain B, Thermostable beta-glucosidase B [Acetivibrio thermocellus AD2]
5WAB_A	4.46e-125	32	742	1	658	CrystalStructure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703],5WAB_B Crystal Structure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703],5WAB_C Crystal Structure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703],5WAB_D Crystal Structure of Bifidobacterium adolescentis GH3 beta-glucosidase [Bifidobacterium adolescentis ATCC 15703]
2X40_A	4.76e-118	34	740	2	706	Structureof beta-glucosidase 3B from Thermotoga neapolitana in complex with glycerol [Thermotoga neapolitana DSM 4359],2X41_A Structure of beta-glucosidase 3B from Thermotoga neapolitana in complex with glucose [Thermotoga neapolitana DSM 4359]
2X42_A	7.17e-117	34	740	2	706	Structureof beta-glucosidase 3B from Thermotoga neapolitana in complex with alpha-D-glucose [Thermotoga neapolitana DSM 4359]
4I3G_A	2.21e-114	10	741	23	822	CrystalStructure of DesR, a beta-glucosidase from Streptomyces venezuelae in complex with D-glucose. [Streptomyces venezuelae],4I3G_B Crystal Structure of DesR, a beta-glucosidase from Streptomyces venezuelae in complex with D-glucose. [Streptomyces venezuelae]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
A7LXS8	4.03e-299	12	746	22	744	Beta-glucosidase BoGH3A OS=Bacteroides ovatus (strain ATCC 8483 / DSM 1896 / JCM 5824 / BCRC 10623 / CCUG 4943 / NCTC 11153) OX=411476 GN=BACOVA_02644 PE=1 SV=1
P14002	1.73e-152	36	739	5	660	Thermostable beta-glucosidase B OS=Acetivibrio thermocellus (strain ATCC 27405 / DSM 1237 / JCM 9322 / NBRC 103400 / NCIMB 10682 / NRRL B-4536 / VPI 7372) OX=203119 GN=bglB PE=1 SV=2
Q5BFG8	1.32e-133	35	748	10	839	Beta-glucosidase B OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=bglB PE=1 SV=1
P27034	7.39e-128	36	747	2	810	Beta-glucosidase OS=Rhizobium radiobacter OX=358 GN=cbg-1 PE=3 SV=1
A2R989	1.58e-121	60	741	9	805	Probable beta-glucosidase I OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) OX=425011 GN=bglI PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000310	0.998936	0.000227	0.000167	0.000175	0.000159

TMHMM  Annotations     

There is no transmembrane helices in MGYG000004003_00555.