CAZyme Information: MGYG000004003_00570

Basic Information

• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Bacteroides
• CAZyme ID: MGYG000004003_00570
• CAZy Family: GH88
• CAZyme Description: Unsaturated chondroitin disaccharide hydrolase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
411		47383.51	5.2969

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000004003	5653807	MAG	United Kingdom	Europe

• Gene Location: Start: 77429; End: 78664 Strand: -

Full Sequence      

MKNLLILLSFPLMGIFTSCGEAAKEKDFVETGFTTAEIQLKNQLAAVPEPTEYPRTVDQD
GKLQTTKLNDWTEGFYPGCLWYLYEWNKEDFWKQAAIKWTEALEPMKTTKHHHDVGFLMY
CSFGNAYRLTGNEKYKDILIESANSLCTRYNETVGCIESWNKRMAWNGKDEWLYPVIIDN
MMNLELLYWASKVTEDPKYAMIATNHARNTAKNQFREDYSNYHVVNYDENTGKVLHKATC
QGFSDNSAWARGQAWAIYGFTMVYRETKEQFFLDMALKTAEFWLNHPNMPEDGIPYWDFN
AGQPGYTPDWKYDPSQFEVVPRDASAAAITASAFLELANYVKNGNKYYKAAEHILKSLSS
PTYLAVPGNNCNFTLMHSVGSIPHGNEIDVPLVYADYYYLEALLKYRKSDI

Enzyme Prediction     

EC	3.2.1.-

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH88	65	406	3.5e-129	0.9908814589665653

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam07470	Glyco_hydro_88	4.34e-15	70	269	28	210	Glycosyl Hydrolase Family 88. Unsaturated glucuronyl hydrolase catalyzes the hydrolytic release of unsaturated glucuronic acids from oligosaccharides (EC:3.2.1.-) produced by the reactions of polysaccharide lyases.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ALJ58165.1	5.21e-230	15	410	13	406
QIU93748.1	1.13e-229	2	410	4	408
QDO70891.1	4.12e-229	1	407	1	404
QUT90817.1	1.22e-228	15	410	13	406
QUT74344.1	2.12e-223	5	407	6	405

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3WIW_A	1.27e-116	27	411	30	396	Crystalstructure of unsaturated glucuronyl hydrolase specific for heparin [Pedobacter heparinus DSM 2366]
2ZZR_A	2.21e-54	52	409	49	392	Crystalstructure of unsaturated glucuronyl hydrolase from Streptcoccus agalactiae [Streptococcus agalactiae]
3ANJ_A	2.27e-54	52	409	50	393	Crystalstructure of unsaturated glucuronyl hydrolase from Streptcoccus agalactiae [Streptococcus agalactiae serogroup III]
3WUX_A	8.73e-54	52	409	50	393	Crystalstructure of unsaturated glucuronyl hydrolase mutant D115N/K370S from Streptococcus agalactiae [Streptococcus agalactiae NEM316]
3ANI_A	1.22e-53	52	409	50	393	Crystalstructure of unsaturated glucuronyl hydrolase mutant D175N from Streptcoccus agalactiae [Streptococcus agalactiae serogroup III],3ANK_A Crystal structure of unsaturated glucuronyl hydrolase mutant D175N from Streptcoccus agalactiae complexed with dGlcA-GalNAc6S [Streptococcus agalactiae serogroup III]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
T2KLZ3	6.85e-102	24	411	29	397	Unsaturated glucuronyl hydrolase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_21900 PE=1 SV=1
Q8E372	1.24e-53	52	409	50	393	Unsaturated chondroitin disaccharide hydrolase OS=Streptococcus agalactiae serotype III (strain NEM316) OX=211110 GN=gbs1889 PE=1 SV=1
Q8DR77	2.46e-52	52	409	48	391	Unsaturated chondroitin disaccharide hydrolase OS=Streptococcus pneumoniae (strain ATCC BAA-255 / R6) OX=171101 GN=ugl PE=1 SV=1
Q9A0T3	2.93e-50	52	409	51	394	Unsaturated chondroitin disaccharide hydrolase OS=Streptococcus pyogenes serotype M1 OX=301447 GN=ugl PE=1 SV=1
Q9RC92	4.78e-50	53	409	24	367	Unsaturated glucuronyl hydrolase OS=Bacillus sp. (strain GL1) OX=84635 GN=ugl PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as LIPO

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000000	0.000007	1.000039	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000004003_00570.