CAZyme Information: MGYG000004003_00612

Basic Information

• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Bacteroides
• CAZyme ID: MGYG000004003_00612
• CAZy Family: GH3
• CAZyme Description: Thermostable beta-glucosidase B

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
796	MGYG000004003_7|CGC1	88061.32	6.1034

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000004003	5653807	MAG	United Kingdom	Europe

• Gene Location: Start: 33919; End: 36309 Strand: +

Full Sequence      

MKKLLCGLTLFLSAGSLLASGSLTGNKPVNSTKDMYKKTWIDFNKNGVKDVYEDPAAPIE
ARIADLLSQMTLEEKTCQMATLYGSGRVLKDAWPTAGWSGEIWKDGIGNIDEQANGLGKF
GSEISYPYANSVKNRHAVQRWFVEQTRLGIPVDFTNEGIRGLCHDRATMFPAQCGQGATW
NKKLIREIAKVTADEAKALGYTNIYSPILDIAQDPRWGRVVESYGEDPYLVGELGKQMIL
GLQAEGIVATPKHFAVYSIPVGGRDGGTRTDPHVAPREMKTLYLEPFRKGIQEAGALGVM
SSYNDYDGEPVSGSYHFLTEILRQQWGFKGYVVSDSEAVEFLHTKHRITPTEEEMAAQVV
NAGLNIRTNFTPPQDFILPLRRAINEGKVSLHTLDQRVGEILRVKFMMGLFDNPYPGDDR
RPEAVVHNAAHQDVSMRAALESIVLLKNEKEMLPLSKSLSKIAVIGPNAEEVKELTCRYG
PAHAPIKTVYQGIKEYLPGSEVRYAKGCDIIDKYFPESELYNVPLDAQEQAMIDEAVELA
KSSDVSILVLGGNEKTVREEFSRTNLDLCGRQQQLLEAVYATGKPVVLVMVDGRAATINW
ANKYIPAIVHAWFPGEFMGDAIAKVLFGDYNPGGRLAVTFPKSVGQIPFAFPFKPGSDSK
GKVRVDGMLYPFGYGLSYTTFGYSDLKISKPVIGPLENITISCTVKNTGKRAGDEVVQLY
IRDDFSSVTTYDKVLRGFERIHLQQGEEQTVNFTLTPQDLGLWDKNNQFTVEPGSFSVMV
GASSQDTRLKGSFEVQ

Enzyme Prediction     

No EC number prediction in MGYG000004003_00612.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH3	144	366	4.7e-66	0.9722222222222222

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK15098	PRK15098	0.0	50	796	22	765	beta-glucosidase BglX.
PLN03080	PLN03080	1.63e-87	147	757	78	744	Probable beta-xylosidase; Provisional
COG1472	BglX	1.25e-82	139	510	49	397	Periplasmic beta-glucosidase and related glycosidases [Carbohydrate transport and metabolism].
pfam01915	Glyco_hydro_3_C	1.08e-71	443	678	1	216	Glycosyl hydrolase family 3 C-terminal domain. This domain is involved in catalysis and may be involved in binding beta-glucan. This domain is found associated with pfam00933.
pfam00933	Glyco_hydro_3	8.79e-60	137	404	53	316	Glycosyl hydrolase family 3 N terminal domain.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QIU93424.1	0.0	1	796	1	801
QNL39935.1	0.0	1	796	1	800
EDO11529.1	0.0	1	796	1	800
ALJ47754.1	0.0	1	796	1	800
SCV07152.1	0.0	1	796	1	800

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5Z87_A	8.52e-141	46	786	30	776	ChainA, EmGH1 [Aurantiacibacter marinus],5Z87_B Chain B, EmGH1 [Aurantiacibacter marinus]
5YOT_A	2.09e-139	49	796	4	757	Isoprimeverose-producingenzyme from Aspergillus oryzae in complex with isoprimeverose [Aspergillus oryzae RIB40],5YOT_B Isoprimeverose-producing enzyme from Aspergillus oryzae in complex with isoprimeverose [Aspergillus oryzae RIB40],5YQS_A Isoprimeverose-producing enzyme from Aspergillus oryzae in complex with isoprimeverose [Aspergillus oryzae RIB40],5YQS_B Isoprimeverose-producing enzyme from Aspergillus oryzae in complex with isoprimeverose [Aspergillus oryzae RIB40]
7EAP_A	1.15e-138	49	796	4	757	ChainA, Fn3_like domain-containing protein [Aspergillus oryzae RIB40]
5XXL_A	2.78e-138	66	788	17	745	Crystalstructure of GH3 beta-glucosidase from Bacteroides thetaiotaomicron [Bacteroides thetaiotaomicron VPI-5482],5XXL_B Crystal structure of GH3 beta-glucosidase from Bacteroides thetaiotaomicron [Bacteroides thetaiotaomicron VPI-5482],5XXM_A Crystal structure of GH3 beta-glucosidase from Bacteroides thetaiotaomicron in complex with gluconolactone [Bacteroides thetaiotaomicron VPI-5482],5XXM_B Crystal structure of GH3 beta-glucosidase from Bacteroides thetaiotaomicron in complex with gluconolactone [Bacteroides thetaiotaomicron VPI-5482]
5XXN_A	1.53e-137	66	788	17	745	CrystalStructure of mutant (D286N) beta-glucosidase from Bacteroides thetaiotaomicron in complex with sophorose [Bacteroides thetaiotaomicron VPI-5482],5XXN_B Crystal Structure of mutant (D286N) beta-glucosidase from Bacteroides thetaiotaomicron in complex with sophorose [Bacteroides thetaiotaomicron VPI-5482],5XXO_A Crystal structure of mutant (D286N) GH3 beta-glucosidase from Bacteroides thetaiotaomicron in complex with sophorotriose [Bacteroides thetaiotaomicron VPI-5482],5XXO_B Crystal structure of mutant (D286N) GH3 beta-glucosidase from Bacteroides thetaiotaomicron in complex with sophorotriose [Bacteroides thetaiotaomicron VPI-5482]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
T2KMH0	2.30e-136	147	790	62	716	Beta-xylosidase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_22130 PE=1 SV=1
P33363	6.05e-130	60	795	35	764	Periplasmic beta-glucosidase OS=Escherichia coli (strain K12) OX=83333 GN=bglX PE=3 SV=2
Q56078	1.81e-128	60	795	35	764	Periplasmic beta-glucosidase OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) OX=99287 GN=bglX PE=3 SV=2
T2KMH9	3.08e-122	52	796	29	755	Putative beta-xylosidase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_22230 PE=2 SV=1
A7LXU3	1.51e-95	54	786	32	767	Beta-glucosidase BoGH3B OS=Bacteroides ovatus (strain ATCC 8483 / DSM 1896 / JCM 5824 / BCRC 10623 / CCUG 4943 / NCTC 11153) OX=411476 GN=BACOVA_02659 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000515	0.998751	0.000216	0.000188	0.000167	0.000151

TMHMM  Annotations     

There is no transmembrane helices in MGYG000004003_00612.