CAZyme Information: MGYG000004003_00816

Basic Information

• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Bacteroides
• CAZyme ID: MGYG000004003_00816
• CAZy Family: CBM6
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
636		72508.46	6.5088

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000004003	5653807	MAG	United Kingdom	Europe

• Gene Location: Start: 58089; End: 59999 Strand: +

Full Sequence      

MINKIICLILLAWLGSVHQVVQAQRDFVHPGITYTKGDLDRMKAMIEAQVEPYYSTFLKL
KASPYSSLAAPVVERGNQIREGQFNGTIGVDGRRAHDLALLWHLTGDEAYARKAVEYLNA
NSYYTNTSSRGTGPLDNGKIYLLIDAAELMRDYAGWKEEDRQRFKDMLVYPGYSNEEDFF
SKYADYWDDSKNGVTFYWNIYNFDAARFGNQGLFAARGMMAMAIYLDNEIMYDRAYRYLL
GMKHRQDDLPYPSGPAVTSKEPIKETPVMLDYQLQGRAKTVSDYGYDEQLQYYIYPNGQC
QESSRDQGHVLAGVHNYVAIAEMAWNQGDSLYSCLDNRILSGLEWNYRYNLSSIQSYDDQ
QTPWEPIGFTKNPEEVTFGNGKYLQVKSRSGRWESVNVSPHGRGDVAGSGGTREMALAHY
AVRAGLPEKDYTWLKRYRDYMIEHHGCENWGVAPHWFYEWTGWGTLTKRLTPWMAGEPVS
FSSGKRVSGIHALPGTIQVADYDYYCLSENPEGHTYHNIGTKRGNEYRPDGAVELKKNGN
EYVVTEVEDGEWLNYTVKVPATKKYTIYVTYQSETKTKLFLASDQGTETALFFLPASGQW
QERKIGELSLSAGACVLRLFIKKAGKELSLGKIHIR

Enzyme Prediction     

No EC number prediction in MGYG000004003_00816.

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd04080	CBM6_cellulase-like	2.16e-15	493	625	1	135	Carbohydrate Binding Module 6 (CBM6); appended to glycoside hydrolase (GH) domains, including GH5 (cellulase). This family includes carbohydrate binding module 6 (CBM6) domains that are appended to several glycoside hydrolase (GH) domains, including GH5 (cellulase) and GH16, as well as to coagulation factor 5/8 carbohydrate-binding domains. CBM6s are non-catalytic carbohydrate binding domains that facilitate the strong binding of the GH catalytic modules with their dedicated, insoluble substrates. The CBM6s are appended to GHs that display a diversity of substrate specificities. For some members of this family information is available about the specific substrates of the appended GH domains. It includes the CBM domains of various enzymes involved in cell wall degradation including, an extracellular beta-1,3-glucanase from Lysobacter enzymogenes encoded by the gluC gene (its catalytic domain belongs to the GH16 family), the tandem CBM domains of Pseudomonas sp. PE2 beta-1,3(4)-glucanase A (its catalytic domain also belongs to GH16), and a family 6 CBM from Cellvibrio mixtus Endoglucanase 5A (CmCBM6) which binds to the beta1,4-beta1,3-mixed linked glucans lichenan, and barley beta-glucan, cello-oligosaccharides, insoluble forms of cellulose, the beta1,3-glucan laminarin, and xylooligosaccharides, and the CBM6 of Fibrobacter succinogenes S85 XynD xylanase, appended to a GH10 domain, and Cellvibrio japonicas Cel5G appended to a GH5 (cellulase) domain. GH5 (cellulase) family includes enzymes with several known activities such as endoglucanase, beta-mannanase, and xylanase, which are involved in the degradation of cellulose and xylans. GH16 family includes enzymes with lichenase, xyloglucan endotransglycosylase (XET), and beta-agarase activities. CBM6 is an unusual CBM as it represents a chimera of two distinct binding sites with different modes of binding: binding site I within the loop regions and binding site II on the concave face of the beta-sandwich fold. For CmCBM6 it has been shown that these two binding sites have different ligand specificities.
pfam05426	Alginate_lyase	3.23e-11	80	246	38	205	Alginate lyase. This family contains several bacterial alginate lyase proteins. Alginate is a family of 1-4-linked copolymers of beta -D-mannuronic acid (M) and alpha -L-guluronic acid (G). It is produced by brown algae and by some bacteria belonging to the genera Azotobacter and Pseudomonas. Alginate lyases catalyze the depolymerization of alginates by beta -elimination, generating a molecule containing 4-deoxy-L-erythro-hex-4-enepyranosyluronate at the nonreducing end. This family adopts an all alpha fold.
smart00606	CBD_IV	0.005	526	601	12	94	Cellulose Binding Domain Type IV.
cd04086	CBM35_mannanase-like	0.009	548	614	33	99	Carbohydrate Binding Module 35 (CBM35); appended to several carbohydrate binding enzymes, including several glycoside hydrolase (GH) family 26 mannanase domains. This family includes carbohydrate binding module 35 (CBM35) domains that are appended to several carbohydrate binding enzymes, including periplasmic component of ABC-type sugar transport system involved in carbohydrate transport and metabolism, and several glycoside hydrolase (GH) domains, including GH26. These CBM6s are non-catalytic carbohydrate binding domains that facilitate the strong binding of the GH catalytic modules with their dedicated, insoluble substrates. Examples of proteins having CMB35s belonging to this family are mannanase A from Clostridium thermocellum (GH26), Man26B from Paenibacillus sp. BME-14 (GH26), and the multifunctional Cel44C-Man26A from Paenibacillus polymyxa GS01 (which has two GH domains, GH44 and GH26). GH26 mainly includes mannan endo-1,4-beta-mannosidase which hydrolyzes 1,4-beta-D-linkages in mannans, galacto-mannans, glucomannans, and galactoglucomannans, but displays little activity towards other plant cell wall polysaccharides. A few proteins belonging to this family have additional CBM3 domains; these CBM3s are not found in the CBM6-CBM35-CBM36_like superfamily.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QGT69471.1	0.0	1	636	1	637
QUT82474.1	0.0	1	636	1	637
QDM08619.1	0.0	1	636	1	637
QRQ56347.1	0.0	1	636	1	637
SCV08998.1	0.0	1	636	1	637

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000201	0.999195	0.000152	0.000160	0.000148	0.000135

TMHMM  Annotations     

There is no transmembrane helices in MGYG000004003_00816.