CAZyme Information: MGYG000004003_00828

Basic Information

• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Bacteroides
• CAZyme ID: MGYG000004003_00828
• CAZy Family: GH28
• CAZyme Description: 2-succinyl-6-hydroxy-2,4-cyclohexadiene-1-carboxylate synthase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
640		71228.11	6.3474

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000004003	5653807	MAG	United Kingdom	Europe

• Gene Location: Start: 73616; End: 75538 Strand: +

Full Sequence      

MKGRLLIVLFVSLCFIAGSCNVSSVRGSHYNFSSLDSVIQGWVSKGYYPGASICVVKNDS
VIFQNNYGNYTPDTKVYVASAGKWVAAAVIGAVVDSTDLGWDDSVEKWLPEFKGDAKGKI
LLRQLLSHTSGVRPYLPEPRIDNYNHLDSAIIEILPLDTVFTPGSQFQYGGLAMQIAGRM
AEVAMGKEFETLFQELLAQPLEMKNSHFTPINTDGGHAPMLGGGLCTTLNDYIHFLSMIY
HEGMYNDKRIISAKTVKEMQADQVKDAIIPSNNSDNYVAKGLGQSHNGIYGLGEWRELID
KKTGEAYQISSPGWAGAYPWINKRENVYGFFIAHVVGASSKEDGFSSFYGSPVISRTVSE
IVKGHPLVVKQGRVEVGNGSLYYEEAGTGAPVIFVHGHSLDHRMWDEQFSVLAKKYRVIR
YDLRGYGISSSQTEDYQFTHAEDLVTLMDSLHIKKAHIVGLSLGGFITADMLAYFPDRML
SAFLASGNIRKSKGPSEPMTPEEARVRDKEIAALKEKGVDVMKKEWFEGLMKSGGSQRER
MRESLWQMIDEWDAWQPLHKEVRVVAGLDAIEELKKNHPDVPALIVEGHSSGNRFSKEPP
ILQYLPNGKLKVIDDCGHMLNMERPEEFNAALEEFLKNVQ

Enzyme Prediction     

No EC number prediction in MGYG000004003_00828.

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG0596	MhpC	1.04e-35	374	639	5	282	Pimeloyl-ACP methyl ester carboxylesterase [Coenzyme transport and metabolism, General function prediction only].
pfam00144	Beta-lactamase	7.19e-33	35	327	1	300	Beta-lactamase. This family appears to be distantly related to pfam00905 and PF00768 D-alanyl-D-alanine carboxypeptidase.
TIGR02427	protocat_pcaD	3.87e-29	381	637	2	251	3-oxoadipate enol-lactonase. Members of this family are 3-oxoadipate enol-lactonase. Note that the substrate is known as 3-oxoadipate enol-lactone, 2-oxo-2,3-dihydrofuran-5-acetate, 4,5-Dihydro-5-oxofuran-2-acetate, and 5-oxo-4,5-dihydrofuran-2-acetate. The enzyme the catalyzes the fourth step in the protocatechuate degradation to beta-ketoadipate and then to succinyl-CoA and acetyl-CoA. 4-hydroxybenzoate, 3-hydroxybenzoate, and vanillate all can be converted in one step to protocatechuate. This enzyme also acts in catechol degradation. In genomes that catabolize both catechol and protocatechuate, two forms of this enzyme may be found. All members of the seed alignment for this model were chosen from within protocatechuate degradation operons of at least three genes of the pathway, from genomes with the complete pathway through beta-ketoadipate. [Energy metabolism, Other]
COG1680	AmpC	3.75e-24	47	328	52	356	CubicO group peptidase, beta-lactamase class C family [Defense mechanisms].
pfam00561	Abhydrolase_1	5.66e-21	391	625	2	245	alpha/beta hydrolase fold. This catalytic domain is found in a very wide range of enzymes.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QUT92203.1	3.49e-150	362	637	511	786
ALJ62047.1	6.95e-150	362	637	511	786
BBM69122.1	6.71e-17	35	257	606	864
BBM72115.1	6.71e-17	35	257	606	864
AYA42662.1	8.87e-17	35	257	608	866

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5TGF_A	6.24e-182	24	362	2	337	ChainA, Uncharacterized protein [Phocaeicola dorei DSM 17855],5TGF_B Chain B, Uncharacterized protein [Phocaeicola dorei DSM 17855],5TGF_C Chain C, Uncharacterized protein [Phocaeicola dorei DSM 17855],5TGF_D Chain D, Uncharacterized protein [Phocaeicola dorei DSM 17855]
5EGN_A	1.31e-19	374	636	4	260	Est816as an N-Acyl homoserine lactone degrading enzyme [uncultured bacterium],5EGN_B Est816 as an N-Acyl homoserine lactone degrading enzyme [uncultured bacterium],5EGN_C Est816 as an N-Acyl homoserine lactone degrading enzyme [uncultured bacterium],5EGN_D Est816 as an N-Acyl homoserine lactone degrading enzyme [uncultured bacterium],5EGN_E Est816 as an N-Acyl homoserine lactone degrading enzyme [uncultured bacterium],5EGN_F Est816 as an N-Acyl homoserine lactone degrading enzyme [uncultured bacterium],5EGN_G Est816 as an N-Acyl homoserine lactone degrading enzyme [uncultured bacterium],5EGN_H Est816 as an N-Acyl homoserine lactone degrading enzyme [uncultured bacterium]
3FOB_A	3.84e-19	381	638	19	281	Crystalstructure of bromoperoxidase from Bacillus anthracis [Bacillus anthracis str. Ames],3FOB_B Crystal structure of bromoperoxidase from Bacillus anthracis [Bacillus anthracis str. Ames],3FOB_C Crystal structure of bromoperoxidase from Bacillus anthracis [Bacillus anthracis str. Ames]
4IQ4_A	1.97e-16	381	640	16	280	Structureof a 16 nm protein cage designed by fusing symmetric oligomeric domains, triple mutant, P21212 form [Kitasatospora aureofaciens],4IQ4_B Structure of a 16 nm protein cage designed by fusing symmetric oligomeric domains, triple mutant, P21212 form [Kitasatospora aureofaciens],4IQ4_C Structure of a 16 nm protein cage designed by fusing symmetric oligomeric domains, triple mutant, P21212 form [Kitasatospora aureofaciens],4IQ4_D Structure of a 16 nm protein cage designed by fusing symmetric oligomeric domains, triple mutant, P21212 form [Kitasatospora aureofaciens],4IQ4_E Structure of a 16 nm protein cage designed by fusing symmetric oligomeric domains, triple mutant, P21212 form [Kitasatospora aureofaciens],4IQ4_F Structure of a 16 nm protein cage designed by fusing symmetric oligomeric domains, triple mutant, P21212 form [Kitasatospora aureofaciens],4ITV_A Structure of a 16 nm protein cage designed by fusing symmetric oligomeric domains, triple mutant, P212121 form [Kitasatospora aureofaciens],4ITV_B Structure of a 16 nm protein cage designed by fusing symmetric oligomeric domains, triple mutant, P212121 form [Kitasatospora aureofaciens],4ITV_C Structure of a 16 nm protein cage designed by fusing symmetric oligomeric domains, triple mutant, P212121 form [Kitasatospora aureofaciens],4ITV_D Structure of a 16 nm protein cage designed by fusing symmetric oligomeric domains, triple mutant, P212121 form [Kitasatospora aureofaciens],4ITV_E Structure of a 16 nm protein cage designed by fusing symmetric oligomeric domains, triple mutant, P212121 form [Kitasatospora aureofaciens],4ITV_F Structure of a 16 nm protein cage designed by fusing symmetric oligomeric domains, triple mutant, P212121 form [Kitasatospora aureofaciens],4ITV_G Structure of a 16 nm protein cage designed by fusing symmetric oligomeric domains, triple mutant, P212121 form [Kitasatospora aureofaciens],4ITV_H Structure of a 16 nm protein cage designed by fusing symmetric oligomeric domains, triple mutant, P212121 form [Kitasatospora aureofaciens],4ITV_I Structure of a 16 nm protein cage designed by fusing symmetric oligomeric domains, triple mutant, P212121 form [Kitasatospora aureofaciens],4ITV_J Structure of a 16 nm protein cage designed by fusing symmetric oligomeric domains, triple mutant, P212121 form [Kitasatospora aureofaciens],4ITV_K Structure of a 16 nm protein cage designed by fusing symmetric oligomeric domains, triple mutant, P212121 form [Kitasatospora aureofaciens],4ITV_L Structure of a 16 nm protein cage designed by fusing symmetric oligomeric domains, triple mutant, P212121 form [Kitasatospora aureofaciens],4IVJ_A Structure of a 16 nm protein cage designed by fusing symmetric oligomeric domains, triple mutant, I222 form [Kitasatospora aureofaciens],4IVJ_B Structure of a 16 nm protein cage designed by fusing symmetric oligomeric domains, triple mutant, I222 form [Kitasatospora aureofaciens],4IVJ_C Structure of a 16 nm protein cage designed by fusing symmetric oligomeric domains, triple mutant, I222 form [Kitasatospora aureofaciens]
1BRO_A	1.98e-16	381	636	15	275	BromoperoxidaseA2 [Kitasatospora aureofaciens],1BRO_B Bromoperoxidase A2 [Kitasatospora aureofaciens]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q55921	5.30e-17	381	637	16	276	Putative non-heme chloroperoxidase OS=Synechocystis sp. (strain PCC 6803 / Kazusa) OX=1111708 GN=slr0314 PE=3 SV=1
P29715	1.10e-15	381	636	16	276	Non-haem bromoperoxidase BPO-A2 OS=Kitasatospora aureofaciens OX=1894 GN=bpoA2 PE=1 SV=3
O31168	4.92e-15	381	636	16	276	Non-heme chloroperoxidase OS=Kitasatospora aureofaciens OX=1894 GN=cpo PE=1 SV=1
P33912	1.56e-14	381	636	12	273	Non-heme chloroperoxidase CPO-A1 OS=Kitasatospora aureofaciens OX=1894 GN=bpoA1 PE=1 SV=3
Q8NUZ4	6.79e-14	35	217	43	238	Protein flp OS=Staphylococcus aureus (strain MW2) OX=196620 GN=flp PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as LIPO

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000353	0.302180	0.697124	0.000122	0.000117	0.000110

TMHMM  Annotations     

There is no transmembrane helices in MGYG000004003_00828.