CAZyme Information: MGYG000004003_00927

Basic Information

• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Bacteroides
• CAZyme ID: MGYG000004003_00927
• CAZy Family: GH89
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
707	MGYG000004003_11|CGC1	80624.1	5.2064

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000004003	5653807	MAG	United Kingdom	Europe

• Gene Location: Start: 23591; End: 25714 Strand: +

Full Sequence      

MYMRFVLTLLLGTIWLCSCQSEKLSVNSLAGRVTEGTSDGRILFRIIADGSNPAKDYFEI
SSENGKVLITGNSDLSLATGLNWYLKYVAGIHLSWNNPSQKLPEVLPLPEEKIRQETAMK
NRYYLNYCTYSYSMAFWDWERWEKEIDWMALHGINMPLSITGMEVVWYNLLKRVGYTTEE
INEFISGPAFMAWWQMNNLEGWGGPNPDSWYQQQEALQKKIVSRMRELGIEPVFPGYAGM
VPRNIGEKLGYQIADPGKWCGFPRPAFLSSEDEHFDSFAAMYYEELEKLYGKAKYYSMDP
FHEGGNTEGVDLAKAGASIMKAMKKANPESVWVIQAWQANPRPAMVDALDAGDMLVLDLY
SERLPQWGDPDSMWYREKGFGKHDWLYCMLLNFGGNVGLHGRMNQLVNGYYDACAHTNGK
TLRGVGATPEGIENNPVMFELLYELPWRAGRFSPDAWLQGYLKARYGGELSPEVLEAWRA
LEHTVYNAPKNYQGEGTVESLLCARPGFHLDRTSTWGYAKLFYSPDSTSKAAGMLLSVAG
QYKGNNNFEYDLVDIVRQSNADKGNVLLEEISQSYDRKDKGNFRKQTRQFLDLILSQDSL
LSTRKEFSVSSWLTAARSLGTTDEEKKLYEWNASALITVWGDSIAANQGGLHDYSHREWS
GLLKDLYYPRWKAFFEQKQQELDGKSVGEAVNFYEMEKAWAEKSHGY

Enzyme Prediction     

No EC number prediction in MGYG000004003_00927.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH89	64	705	2.5e-248	0.9668174962292609

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam05089	NAGLU	0.0	122	449	1	333	Alpha-N-acetylglucosaminidase (NAGLU) tim-barrel domain. Alpha-N-acetylglucosaminidase, a lysosomal enzyme required for the stepwise degradation of heparan sulfate. Mutations on the alpha-N-acetylglucosaminidase (NAGLU) gene can lead to Mucopolysaccharidosis type IIIB (MPS IIIB; or Sanfilippo syndrome type B) characterized by neurological dysfunction but relatively mild somatic manifestations. The structure shows that the enzyme is composed of three domains. This central domain has a tim barrel fold.
pfam12972	NAGLU_C	2.30e-84	457	707	1	245	Alpha-N-acetylglucosaminidase (NAGLU) C-terminal domain. Alpha-N-acetylglucosaminidase, a lysosomal enzyme required for the stepwise degradation of heparan sulfate. Mutations on the alpha-N-acetylglucosaminidase (NAGLU) gene can lead to Mucopolysaccharidosis type IIIB (MPS IIIB; or Sanfilippo syndrome type B) characterized by neurological dysfunction but relatively mild somatic manifestations. The structure shows that the enzyme is composed of three domains. This C-terminal domain has an all alpha helical fold.
pfam12971	NAGLU_N	2.20e-22	26	107	3	81	Alpha-N-acetylglucosaminidase (NAGLU) N-terminal domain. Alpha-N-acetylglucosaminidase, a lysosomal enzyme required for the stepwise degradation of heparan sulfate. Mutations on the alpha-N-acetylglucosaminidase (NAGLU) gene can lead to Mucopolysaccharidosis type IIIB (MPS IIIB; or Sanfilippo syndrome type B) characterized by neurological dysfunction but relatively mild somatic manifestations. The structure shows that the enzyme is composed of three domains. This N-terminal domain has an alpha-beta fold.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QQT77518.1	0.0	1	707	1	707
QRP57238.1	0.0	1	707	1	707
ASM65926.1	0.0	1	707	1	707
QIU94744.1	0.0	1	707	1	707
QUU08103.1	0.0	1	707	1	707

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
2VC9_A	2.74e-163	26	703	174	849	Family89 Glycoside Hydrolase from Clostridium perfringens in complex with 2-acetamido-1,2-dideoxynojirmycin [Clostridium perfringens],2VCA_A Family 89 glycoside hydrolase from Clostridium perfringens in complex with beta-N-acetyl-D-glucosamine [Clostridium perfringens],2VCB_A Family 89 Glycoside Hydrolase from Clostridium perfringens in complex with PUGNAc [Clostridium perfringens],2VCC_A Family 89 Glycoside Hydrolase from Clostridium perfringens [Clostridium perfringens]
7MFK_A	3.42e-163	26	703	182	857	ChainA, Alpha-N-acetylglucosaminidase family protein [Clostridium perfringens ATCC 13124],7MFL_A Chain A, Alpha-N-acetylglucosaminidase family protein [Clostridium perfringens ATCC 13124]
4A4A_A	4.03e-162	26	703	197	872	CpGH89(E483Q, E601Q), from Clostridium perfringens, in complex with its substrate GlcNAc-alpha-1,4-galactose [Clostridium perfringens]
4XWH_A	1.02e-114	51	676	35	657	Crystalstructure of the human N-acetyl-alpha-glucosaminidase [Homo sapiens]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q9FNA3	1.43e-121	45	705	67	775	Alpha-N-acetylglucosaminidase OS=Arabidopsis thaliana OX=3702 GN=NAGLU PE=2 SV=1
P54802	1.01e-113	51	676	58	680	Alpha-N-acetylglucosaminidase OS=Homo sapiens OX=9606 GN=NAGLU PE=1 SV=2

SignalP and Lipop Annotations

This protein is predicted as LIPO

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000023	0.022365	0.977607	0.000008	0.000012	0.000009

TMHMM  Annotations     

There is no transmembrane helices in MGYG000004003_00927.