CAZyme Information: MGYG000004003_00961

Basic Information

• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Bacteroides
• CAZyme ID: MGYG000004003_00961
• CAZy Family: GH2
• CAZyme Description: Beta-galactosidase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
938	MGYG000004003_11|CGC2	106515.23	7.7847

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000004003	5653807	MAG	United Kingdom	Europe

• Gene Location: Start: 64307; End: 67123 Strand: +

Full Sequence      

MKSYNMKSFLLIVLLGISSISTAQSLLDLSGNWGLALDSMNVGEKEEWYLKSFSESISLP
GTTDLAQKGIPNQLVPKLEKPQLLRLTRKNSYVGVAWYNREIDIPKSMAGQPLEFSFERV
LWQSRLWIGGEEVAGAQESLIAPHRFVLPKGLPAGKHMITLRIDNRKRYDISANDLAHAY
TNDTQIMWNGVLGKMKLTTRQKIRIEHVNVYPDVRNGKIRVAVTLENSGHKQEKVKLTLQ
VGQPSVGQKFEEKEFQVTLKGGRQKLEYDCQLGMDIKKWNEFTPELYNLSVVCRFDRKKT
ERKDVSFGMREIDNGQGILTVNGNRIFLRGTLECCIFPLTGTPPMTEEGWMKVFTTAKEW
GLNHLRFHSWCPPEAAFSVADKLGFYLQVELPNWSYTIGKDEAMTKFLYNEFDRIIETYG
NHPSFCMMSVGNELQYDFKLLNDMVRYMKGRDSRRLYTTSTFTFEKGHGAKPEPEDDFFV
TQWTDKGWVRGQGIFDQEPPCFYKDYSAAMQDMNVPLISHEIGQYAVFPNLKEIEKYTGV
LEPLNFKAVKQDLQRKGLYSKAGDFLEASGKLAVLLYKEEIERAMKTKKFSGFQLLDLHD
FPGQGTALVGLLDAFWDSKGLIEPSVFRQFCAPVVPLARFAKATYSGDETFAASIEVANY
SDTAIDNKRILWQLADEAGTQISNGRLDVESISKGNVTQCGDIRAELKSVCKASRLYFTV
SIEGTQWKNTWSVWVYPHIESLNVGDVLLTQNVEEALAALNQGRKVLLSPKVNYLKGLEG
KFLPVFWSPVHFPKQAGTMGLLCNPRHVALRHFPTEMHSNWQWWNLVKRSKVLVADSLPP
VEPIVESVDNFTNNRKLVSVFETRCGKGKLIMSAMDILSEGSDKPEIQQMLYSLVTYMNS
ESFAPRTVLGEDDIRSLILKNEGEVIETKATSIYRGLD

Enzyme Prediction     

No EC number prediction in MGYG000004003_00961.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH2	21	512	9.8e-62	0.5438829787234043

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG3250	LacZ	5.17e-22	24	465	10	442	Beta-galactosidase/beta-glucuronidase [Carbohydrate transport and metabolism].
pfam00703	Glyco_hydro_2	1.85e-14	203	310	1	106	Glycosyl hydrolases family 2. This family contains beta-galactosidase, beta-mannosidase and beta-glucuronidase activities.
PRK10150	PRK10150	9.83e-11	25	330	11	296	beta-D-glucuronidase; Provisional
pfam02837	Glyco_hydro_2_N	8.14e-10	29	190	4	156	Glycosyl hydrolases family 2, sugar binding domain. This family contains beta-galactosidase, beta-mannosidase and beta-glucuronidase activities and has a jelly-roll fold. The domain binds the sugar moiety during the sugar-hydrolysis reaction.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ASM65962.1	0.0	1	938	1	938
QRP59794.1	0.0	6	938	1	933
QQT79911.1	0.0	6	938	1	933
QUU08147.1	0.0	6	938	1	933
QVJ82312.1	0.0	21	934	5	877

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6SD0_A	1.33e-22	24	456	37	463	Structureof beta-galactosidase from Thermotoga maritima. [Thermotoga maritima MSB8],6SD0_B Structure of beta-galactosidase from Thermotoga maritima. [Thermotoga maritima MSB8],6SD0_C Structure of beta-galactosidase from Thermotoga maritima. [Thermotoga maritima MSB8],6SD0_D Structure of beta-galactosidase from Thermotoga maritima. [Thermotoga maritima MSB8]
6S6Z_A	1.33e-22	24	456	36	462	Structureof beta-Galactosidase from Thermotoga maritima [Thermotoga maritima MSB8],6S6Z_B Structure of beta-Galactosidase from Thermotoga maritima [Thermotoga maritima MSB8],6S6Z_C Structure of beta-Galactosidase from Thermotoga maritima [Thermotoga maritima MSB8],6S6Z_D Structure of beta-Galactosidase from Thermotoga maritima [Thermotoga maritima MSB8],6S6Z_E Structure of beta-Galactosidase from Thermotoga maritima [Thermotoga maritima MSB8],6S6Z_F Structure of beta-Galactosidase from Thermotoga maritima [Thermotoga maritima MSB8],6S6Z_G Structure of beta-Galactosidase from Thermotoga maritima [Thermotoga maritima MSB8],6S6Z_H Structure of beta-Galactosidase from Thermotoga maritima [Thermotoga maritima MSB8]
6D8K_A	2.50e-12	29	629	38	581	Bacteroidesmultiple species beta-glucuronidase [Bacteroides ovatus],6D8K_B Bacteroides multiple species beta-glucuronidase [Bacteroides ovatus],6D8K_C Bacteroides multiple species beta-glucuronidase [Bacteroides ovatus],6D8K_D Bacteroides multiple species beta-glucuronidase [Bacteroides ovatus]
4YPJ_A	6.61e-09	60	458	32	440	ChainA, Beta galactosidase [Niallia circulans],4YPJ_B Chain B, Beta galactosidase [Niallia circulans]
3K4A_A	6.68e-08	29	165	17	138	Crystalstructure of selenomethionine substituted E. coli beta-glucuronidase [Escherichia coli K-12],3K4A_B Crystal structure of selenomethionine substituted E. coli beta-glucuronidase [Escherichia coli K-12]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q56307	7.28e-22	24	456	37	463	Beta-galactosidase OS=Thermotoga maritima (strain ATCC 43589 / DSM 3109 / JCM 10099 / NBRC 100826 / MSB8) OX=243274 GN=lacZ PE=1 SV=2
O52847	3.25e-13	29	510	61	552	Beta-galactosidase OS=Priestia megaterium (strain DSM 319 / IMG 1521) OX=592022 GN=bgaM PE=3 SV=1
A7FH78	5.14e-10	29	510	62	558	Beta-galactosidase OS=Yersinia pseudotuberculosis serotype O:1b (strain IP 31758) OX=349747 GN=lacZ PE=3 SV=1
A9R0J8	6.71e-10	29	510	52	548	Beta-galactosidase OS=Yersinia pestis bv. Antiqua (strain Angola) OX=349746 GN=lacZ PE=3 SV=1
Q1CI76	6.73e-10	29	510	62	558	Beta-galactosidase OS=Yersinia pestis bv. Antiqua (strain Nepal516) OX=377628 GN=lacZ PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000242	0.999083	0.000194	0.000158	0.000151	0.000140

TMHMM  Annotations     

There is no transmembrane helices in MGYG000004003_00961.