CAZyme Information: MGYG000004003_01089

Basic Information

• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Bacteroides
• CAZyme ID: MGYG000004003_01089
• CAZy Family: GT2
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
821	MGYG000004003_13|CGC3	94750.23	6.4134

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000004003	5653807	MAG	United Kingdom	Europe

• Gene Location: Start: 79672; End: 82137 Strand: -

Full Sequence      

MKATINCFLPFSRLEETVQTVKELRASALVDKIYLLASPITNVCLPGCELISVEKMQSTQ
AMQAIAEHSDKAYTLLYTKRTALKIGLFALERMVQVMEMTQAGMVYADHYQQVDDVLKPA
PVIDYQPGSLRDDFDFGSVLLFDTNAFKKAIKETEEEYQYAGLYDLRLKISQKNKLVHIN
EYLYTEVESDKRKSGEKQFDYVDPKNRQVQIEMEQACTKHLKEIGGYLHPIFHPIDFSSH
TFEYEASVIIPVRNRIRTIKDAVRSALNQQTTFPFNVIVIDNHSTDGTTEALQELSVDKR
LIHVIPERDDLGIGGCWNVGIHHEKCGKFAVQLDSDDVYKDEHSLQIIIDTFYKQKCAMV
IGTYMMTNFDMQEIAPGIIDHKEWTPDNGRNNALRINGLGAPRAFYTPILRKIKVPNTSY
GEDYALGLKISHDYQIGRIYDVIYLCRRWEGNSDAALPVEKVNQNNLYKDRLRTWELKQR
ILQQETTLEKIQQRIEQLFQKQTLSWELAKENYQALEQYQSRTKEIGKWMGNSHLGAKLF
LNPKRILSATAQTDTVSIHSRPCFLCQTNRPQEQEFLSFGNYQILVNPYPIFKHHFTIVD
KEHKPQSIAGRFKDMIELTDIMKEYFLLYNGPECGASAPDHAHFQACSKEESLQGTYNDS
IELIDNDKVLINYADFPYSFIHIEAENKRTMSKTFHLIYDILAANNNGKEPMMNILAWYG
LIRTKDSFGKNYEDELKAATTHPYKCVIFLRSKHRPDCYYAKGDEQILISPAIAEMNGIF
PIVREEDMEKLTPEKVYDIYKEVSISKEKLQEIAERIKAAL

Enzyme Prediction     

No EC number prediction in MGYG000004003_01089.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT2	247	384	6.5e-19	0.788235294117647

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam16269	DUF4922	7.34e-68	611	811	1	188	Domain of unknown function (DUF4922). This family consists of uncharacterized proteins around 310 residues in length and is mainly found in various Bacteroides and Parabacteroides species. Several members are annotated as putative glycosyltransferases, but the specific function of this family is still unknown.
cd00761	Glyco_tranf_GTA_type	2.36e-22	248	374	1	127	Glycosyltransferase family A (GT-A) includes diverse families of glycosyl transferases with a common GT-A type structural fold. Glycosyltransferases (GTs) are enzymes that synthesize oligosaccharides, polysaccharides, and glycoconjugates by transferring the sugar moiety from an activated nucleotide-sugar donor to an acceptor molecule, which may be a growing oligosaccharide, a lipid, or a protein. Based on the stereochemistry of the donor and acceptor molecules, GTs are classified as either retaining or inverting enzymes. To date, all GT structures adopt one of two possible folds, termed GT-A fold and GT-B fold. This hierarchy includes diverse families of glycosyl transferases with a common GT-A type structural fold, which has two tightly associated beta/alpha/beta domains that tend to form a continuous central sheet of at least eight beta-strands. The majority of the proteins in this superfamily are Glycosyltransferase family 2 (GT-2) proteins. But it also includes families GT-43, GT-6, GT-8, GT13 and GT-7; which are evolutionarily related to GT-2 and share structure similarities.
pfam00535	Glycos_transf_2	6.82e-18	247	413	1	163	Glycosyl transferase family 2. Diverse family, transferring sugar from UDP-glucose, UDP-N-acetyl- galactosamine, GDP-mannose or CDP-abequose, to a range of substrates including cellulose, dolichol phosphate and teichoic acids.
COG0463	WcaA	4.39e-15	247	366	6	117	Glycosyltransferase involved in cell wall bisynthesis [Cell wall/membrane/envelope biogenesis].
cd06433	GT_2_WfgS_like	4.49e-15	247	454	1	200	WfgS and WfeV are involved in O-antigen biosynthesis. Escherichia coli WfgS and Shigella dysenteriae WfeV are glycosyltransferase 2 family enzymes involved in O-antigen biosynthesis. GT-2 enzymes have GT-A type structural fold, which has two tightly associated beta/alpha/beta domains that tend to form a continuous central sheet of at least eight beta-strands. These are enzymes that catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds. Glycosyltransferases have been classified into more than 90 distinct sequence based families.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ANU56201.1	0.0	1	821	1	821
QQR18959.1	0.0	1	821	1	821
QUR44897.1	0.0	1	821	1	821
QUT32432.1	0.0	1	821	1	821
QDH54076.1	0.0	1	821	1	821

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q57287	1.47e-06	247	434	8	188	Uncharacterized glycosyltransferase HI_1578 OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) OX=71421 GN=HI_1578 PE=3 SV=1
O32268	2.79e-06	247	394	9	153	Putative teichuronic acid biosynthesis glycosyltransferase TuaG OS=Bacillus subtilis (strain 168) OX=224308 GN=tuaG PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000065	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000004003_01089.