CAZyme Information: MGYG000004003_01516

Basic Information

• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Bacteroides
• CAZyme ID: MGYG000004003_01516
• CAZy Family: GH3
• CAZyme Description: Beta-glucosidase BoGH3B

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
771	MGYG000004003_20|CGC4	85927.56	7.0489

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000004003	5653807	MAG	United Kingdom	Europe

• Gene Location: Start: 54175; End: 56490 Strand: -

Full Sequence      

MKIKLLSILLIAFQPLAFGTNDIPERPLYLDSSQPVRTRVENLMSLMTLKEKIAQMCQYV
GLEHMRDAEKNITEEELLNGHARGFYKGLHSTGVERMVTQGEIGSFLHVLTPAEANHLQK
LAEKSRLKIPLLIGIDAIHGNGLVSGSTIYPSPIGMASTFAPDLIEQASRQTALEMRATG
SHWAFTPNIEIACDARWGRVGETFGEDPYLVSRMGVASIKGLQTDNLTGLNTVLACAKHL
IAGGIANNGTNAGPVELSEGKLRNFFLPPFKAAIQEAKPFTLMPAHNELNGVPCHANKWL
MTDIMRNEYGFDGFIVSDWMDMEAISTRHRIAENTTDAFFLSVDGGVDMHMHGPVFSDAI
LKLIKEGRLTEERINKACAKILEAKFRLGLFENRYVTEAGIKKTVFSKEHQQTALEIARR
SIVLLKNEALLPIDARKFKKILVTGPNANNQSIMGDWVFEQPEKNVSTILKGIKEEASGT
QINYVDVGWNLRALDSAKIEEAVQTAKSSDLAIVVVGEDSFRQHWKEKTCGENRDRMDIT
LWGKQDYLVESIYKTGVPTIVILVNGRPLATGWIAENIPAIIEAWEPGSMGGKAIAEILF
GKVNPSGKLPITIPRHVGQISTVYNHKPSQFLHPYIDGDKTPLYPFGYGLSYTSFKYGQL
KANKTDYNANEEIEVTVNVSNTGERQGEEIVQLYIRDDYSNTTRPVKELKRFQRILLEKG
ESKVVTFHLNKEDLSYYNHKAEYVLEPGTFTVMVGGSSLDKDLQKVKFNVK

Enzyme Prediction     

No EC number prediction in MGYG000004003_01516.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH3	122	351	6.5e-73	0.9861111111111112

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK15098	PRK15098	0.0	1	769	2	763	beta-glucosidase BglX.
COG1472	BglX	2.39e-100	47	457	1	371	Periplasmic beta-glucosidase and related glycosidases [Carbohydrate transport and metabolism].
PLN03080	PLN03080	1.99e-85	5	755	8	769	Probable beta-xylosidase; Provisional
pfam00933	Glyco_hydro_3	1.55e-79	48	384	1	316	Glycosyl hydrolase family 3 N terminal domain.
pfam01915	Glyco_hydro_3_C	1.13e-68	422	652	1	216	Glycosyl hydrolase family 3 C-terminal domain. This domain is involved in catalysis and may be involved in binding beta-glucan. This domain is found associated with pfam00933.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QIU95347.1	0.0	1	771	1	771
QDH55225.1	0.0	1	771	1	771
QNL37131.1	0.0	1	771	1	771
QUT88989.1	0.0	1	771	1	769
QNL39934.1	0.0	29	771	28	770

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5XXL_A	9.84e-150	32	771	6	752	Crystalstructure of GH3 beta-glucosidase from Bacteroides thetaiotaomicron [Bacteroides thetaiotaomicron VPI-5482],5XXL_B Crystal structure of GH3 beta-glucosidase from Bacteroides thetaiotaomicron [Bacteroides thetaiotaomicron VPI-5482],5XXM_A Crystal structure of GH3 beta-glucosidase from Bacteroides thetaiotaomicron in complex with gluconolactone [Bacteroides thetaiotaomicron VPI-5482],5XXM_B Crystal structure of GH3 beta-glucosidase from Bacteroides thetaiotaomicron in complex with gluconolactone [Bacteroides thetaiotaomicron VPI-5482]
5XXN_A	5.46e-149	32	771	6	752	CrystalStructure of mutant (D286N) beta-glucosidase from Bacteroides thetaiotaomicron in complex with sophorose [Bacteroides thetaiotaomicron VPI-5482],5XXN_B Crystal Structure of mutant (D286N) beta-glucosidase from Bacteroides thetaiotaomicron in complex with sophorose [Bacteroides thetaiotaomicron VPI-5482],5XXO_A Crystal structure of mutant (D286N) GH3 beta-glucosidase from Bacteroides thetaiotaomicron in complex with sophorotriose [Bacteroides thetaiotaomicron VPI-5482],5XXO_B Crystal structure of mutant (D286N) GH3 beta-glucosidase from Bacteroides thetaiotaomicron in complex with sophorotriose [Bacteroides thetaiotaomicron VPI-5482]
5Z87_A	4.79e-147	119	770	113	784	ChainA, EmGH1 [Aurantiacibacter marinus],5Z87_B Chain B, EmGH1 [Aurantiacibacter marinus]
5TF0_A	5.25e-143	40	758	13	740	CrystalStructure of Glycosil Hydrolase Family 3 N-Terminal Domain Protein from Bacteroides intestinalis [Bacteroides intestinalis DSM 17393],5TF0_B Crystal Structure of Glycosil Hydrolase Family 3 N-Terminal Domain Protein from Bacteroides intestinalis [Bacteroides intestinalis DSM 17393]
6R5I_A	2.45e-142	40	755	7	719	ChainA, Periplasmic beta-glucosidase [Pseudomonas aeruginosa PAO1],6R5I_B Chain B, Periplasmic beta-glucosidase [Pseudomonas aeruginosa PAO1],6R5N_A Chain A, Periplasmic beta-glucosidase [Pseudomonas aeruginosa PAO1],6R5N_B Chain B, Periplasmic beta-glucosidase [Pseudomonas aeruginosa PAO1]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
T2KMH0	7.01e-169	115	771	51	723	Beta-xylosidase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_22130 PE=1 SV=1
Q56078	4.24e-130	11	758	13	754	Periplasmic beta-glucosidase OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) OX=99287 GN=bglX PE=3 SV=2
P33363	3.53e-128	94	758	68	754	Periplasmic beta-glucosidase OS=Escherichia coli (strain K12) OX=83333 GN=bglX PE=3 SV=2
T2KMH9	3.23e-126	29	771	29	755	Putative beta-xylosidase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_22230 PE=2 SV=1
A7LXU3	5.01e-116	36	760	35	767	Beta-glucosidase BoGH3B OS=Bacteroides ovatus (strain ATCC 8483 / DSM 1896 / JCM 5824 / BCRC 10623 / CCUG 4943 / NCTC 11153) OX=411476 GN=BACOVA_02659 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000256	0.999125	0.000185	0.000142	0.000141	0.000133

TMHMM  Annotations     

There is no transmembrane helices in MGYG000004003_01516.