CAZyme Information: MGYG000004003_01649

Basic Information

• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Bacteroides
• CAZyme ID: MGYG000004003_01649
• CAZy Family: GH30
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
541	MGYG000004003_23|CGC1	60746.34	4.6076

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000004003	5653807	MAG	United Kingdom	Europe

• Gene Location: Start: 18807; End: 20432 Strand: +

Full Sequence      

MKHRNLFIGLSCMAAGLCACNDEYTFVPEYEVKLPTDTTINVTIDASTVYQTIDGFASSD
AWDMEYVGKYWSTSNKEAIARLLFSCDVDDKGNSSGIGLSMWRFNLGGGSEEQDDASGIV
SDKKERRVECFLTGANGGYDWSKSAGRRYFMEKAKEYGCESFVLFSNTPPVYYTYNGQAR
SDKGAWSNLKPEHYDDFADFLATCAKHFVDEGYNISHISPVNEPQYNWNGNEQEGSAWQN
TEVATLAKALDASLTAKGLTDTQMLLAEAGKWDYLYGNGDAGSARGDVIEAFFNPGNTDT
YIGDLAHLPKLICGHSYWLDTNWSNMYSVRSSVKSKAEQYGLKVYQTEWSMLSENYEDYA
SYGDASYMDLALSMAKVIHQDLATANVSSWSYWTTCSRERWSQKSRFYLIRLSPDGKDGE
SYEDLATNGTYKASKNLWVLGNYSAFVRPGYQRIDLKMEEETKDFFATAYISPEKDKLVV
VYTNMTDKRAEINNTFEGLGKEVGGFEQYTTSEAKDLKREPGYNKGVVPAKGISTFIYTL
Q

Enzyme Prediction     

EC	3.2.1.38

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH30	41	537	3.9e-169	0.9958677685950413

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam14587	Glyco_hydr_30_2	1.83e-119	44	397	6	357	O-Glycosyl hydrolase family 30.
COG5520	XynC	1.90e-08	41	541	35	431	O-Glycosyl hydrolase [Cell wall/membrane/envelope biogenesis].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QGT72500.1	0.0	1	541	1	541
QIU93356.1	1.37e-232	1	541	1	530
SCD19763.1	2.17e-176	17	538	15	525
QIK59847.1	2.30e-175	12	517	11	508
QIK54438.1	4.62e-175	12	517	11	508

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3CLW_A	4.71e-75	44	537	10	495	Crystalstructure of conserved exported protein from Bacteroides fragilis [Bacteroides fragilis NCTC 9343],3CLW_B Crystal structure of conserved exported protein from Bacteroides fragilis [Bacteroides fragilis NCTC 9343],3CLW_C Crystal structure of conserved exported protein from Bacteroides fragilis [Bacteroides fragilis NCTC 9343],3CLW_D Crystal structure of conserved exported protein from Bacteroides fragilis [Bacteroides fragilis NCTC 9343],3CLW_E Crystal structure of conserved exported protein from Bacteroides fragilis [Bacteroides fragilis NCTC 9343],3CLW_F Crystal structure of conserved exported protein from Bacteroides fragilis [Bacteroides fragilis NCTC 9343]
4FMV_A	5.40e-11	151	537	70	385	CrystalStructure Analysis of a GH30 Endoxylanase from Clostridium papyrosolvens C71 [Ruminiclostridium papyrosolvens DSM 2782]
7NCX_AAA	2.18e-10	42	454	12	366	ChainAAA, GH30 family xylanase [Thermothelomyces thermophilus ATCC 42464]
7O0E_A	2.69e-10	42	454	5	359	ChainA, GH30 family xylanase [Thermothelomyces thermophilus ATCC 42464],7O0E_G Chain G, GH30 family xylanase [Thermothelomyces thermophilus ATCC 42464]
6M5Z_A	8.34e-10	42	454	25	370	ChainA, GH30 Xylanase C [Talaromyces cellulolyticus CF-2612],6M5Z_B Chain B, GH30 Xylanase C [Talaromyces cellulolyticus CF-2612]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q76FP5	1.50e-15	30	534	14	474	Endo-beta-1,6-galactanase OS=Hypocrea rufa OX=5547 GN=6GAL PE=1 SV=1
G2Q1N4	2.89e-10	42	454	29	383	GH30 family xylanase OS=Myceliophthora thermophila (strain ATCC 42464 / BCRC 31852 / DSM 1799) OX=573729 GN=Xyn30A PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as LIPO

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000000	0.000060	1.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000004003_01649.