CAZyme Information: MGYG000004003_02152

Basic Information

• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Bacteroides
• CAZyme ID: MGYG000004003_02152
• CAZy Family: GH2
• CAZyme Description: Beta-galactosidase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
882	MGYG000004003_34|CGC1	101466.22	6.2194

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000004003	5653807	MAG	United Kingdom	Europe

• Gene Location: Start: 2250; End: 4898 Strand: -

Full Sequence      

MIFSLTGKKAQIACGLLCCCSMAYAQSNDNSEVVILHSGWEFAQAGTELWRTAEVPGTVH
QDLIYHKLLPSPFYGTNEQKIQWVENEDWEYRTSFAVTAEQLKRDDAQLIFEGLDTYADV
YLNGSLLLKADNMFVGYSLPVKPQLRPGENLLHIYFHSPIRQTLPQYASNGFNYPADNDH
HEKHLSVFSRKAPYSYGWDWGIRMVTSGIWRPVKLRFYDAASINDYHVRQLSLTEQSAKL
SNELQITNILSHPLQAEVRISYSFEKGEESVVNRPVTLQPGINFVRIPSEVVSPVRWMPN
GWGKPALYDFSAQVVSDGKVVAEQSHRIGLRTVRLVNEKDADGESFYFEVNGIPMFAKGA
NYIPQDALLTNVTTERYQTLFHDIKEANMNVIRVWGGGTYEDDRFYDLADENGILVWQDF
MFACTPYPSDPTFLKRVEAEACYNIRRLRNHPSLAMWCGNNEILEALKYWGYQKKYTPEI
YQEMMTGYDKLFRELLPAKVKELDADRFYVHSSPYLANWGRPESWGIGDSHNWGVWYGKK
PFESLDTDLPRFMSEFGFQSFPEMKTIATFASPEDYQIESEVMNAHQKSSIGNDLIRTYM
ERDYIVPDKFEDFVYVGLVLQGQGIRHGLEAHRRNRPYCMGTLYWQLNDSWPVVSWSGID
YYGNWKALHYQAKRAFAPIHINPVQQNDSLCVYILSDCLDTMEKMTLEMKITDFEGKKAG
KPVLLKSFSVPANTSKCVYRAKQDDLLSFAERKSTGTSQSSTDTRLSEMFRHCFMQLTLK
DGSGRIIDETVYFFEKTKDLLLPETTITCKMKQTDGKCELTLLSPALAKDVFIEVPLQGA
RFSDNFFDLLPGERKTVIITSPRIKKGEELPLRLRHIRETYN

Enzyme Prediction     

EC	3.2.1.25

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH2	23	745	1.2e-110	0.7101063829787234

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG3250	LacZ	1.22e-108	31	874	9	801	Beta-galactosidase/beta-glucuronidase [Carbohydrate transport and metabolism].
pfam17753	Ig_mannosidase	8.80e-18	804	879	1	78	Ig-fold domain. This Ig-like fold domain is found in mannosidase enzymes.
PRK10340	ebgA	2.48e-15	85	462	107	449	cryptic beta-D-galactosidase subunit alpha; Reviewed
pfam00703	Glyco_hydro_2	3.77e-15	221	331	1	106	Glycosyl hydrolases family 2. This family contains beta-galactosidase, beta-mannosidase and beta-glucuronidase activities.
pfam17786	Mannosidase_ig	3.99e-13	688	799	1	91	Mannosidase Ig/CBM-like domain. This domain corresponds to domain 4 in the structure of Bacteroides thetaiotaomicron beta-mannosidase, BtMan2A. This domain has an Ig-like fold.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QIU95643.1	0.0	1	882	1	882
QUU08751.1	0.0	1	882	1	870
QQT76953.1	0.0	1	882	1	870
ASM66468.1	0.0	1	882	1	870
QRP57799.1	0.0	1	882	1	870

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
2VJX_A	0.0	26	881	1	838	Structuraland biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VJX_B Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VL4_A Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VL4_B Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VMF_A Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VMF_B Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VO5_A Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VO5_B Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VOT_A Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VOT_B Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron VPI-5482],2VQT_A Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron],2VQT_B Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron],2VR4_A Transition-state mimicry in mannoside hydrolysis: characterisation of twenty six inhibitors and insight into binding from linear free energy relationships and 3-D structure [Bacteroides thetaiotaomicron VPI-5482],2VR4_B Transition-state mimicry in mannoside hydrolysis: characterisation of twenty six inhibitors and insight into binding from linear free energy relationships and 3-D structure [Bacteroides thetaiotaomicron VPI-5482]
7OP6_A	0.0	26	881	3	840	ChainA, Beta-mannosidase [Bacteroides thetaiotaomicron VPI-5482],7OP6_B Chain B, Beta-mannosidase [Bacteroides thetaiotaomicron VPI-5482],7OP7_A Chain A, Beta-mannosidase [Bacteroides thetaiotaomicron VPI-5482],7OP7_B Chain B, Beta-mannosidase [Bacteroides thetaiotaomicron VPI-5482]
2WBK_A	0.0	26	881	1	838	Structureof the Michaelis complex of beta-mannosidase, Man2A, provides insight into the conformational itinerary of mannoside hydrolysis [Bacteroides thetaiotaomicron VPI-5482],2WBK_B Structure of the Michaelis complex of beta-mannosidase, Man2A, provides insight into the conformational itinerary of mannoside hydrolysis [Bacteroides thetaiotaomicron VPI-5482]
2JE8_A	0.0	26	881	3	840	Structureof a beta-mannosidase from Bacteroides thetaiotaomicron [Bacteroides thetaiotaomicron VPI-5482],2JE8_B Structure of a beta-mannosidase from Bacteroides thetaiotaomicron [Bacteroides thetaiotaomicron VPI-5482]
2VQU_A	0.0	26	881	1	838	Structuraland biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron],2VQU_B Structural and biochemical evidence for a boat-like transition state in beta-mannosidases [Bacteroides thetaiotaomicron]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q0CCA0	1.67e-128	36	877	9	841	Beta-mannosidase B OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) OX=341663 GN=mndB PE=3 SV=2
B8NW36	8.61e-123	36	877	9	842	Beta-mannosidase B OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / IAM 13836 / NRRL 3357 / JCM 12722 / SRRC 167) OX=332952 GN=mndB PE=3 SV=1
Q2TXB7	1.20e-122	36	877	9	842	Beta-mannosidase B OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) OX=510516 GN=mndB PE=3 SV=3
Q95327	1.13e-120	16	881	8	879	Beta-mannosidase OS=Capra hircus OX=9925 GN=MANBA PE=1 SV=1
A1CGA8	1.42e-119	36	859	9	828	Beta-mannosidase B OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1 / QM 1276 / 107) OX=344612 GN=mndB PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.006158	0.541604	0.449810	0.001180	0.000696	0.000523

TMHMM  Annotations     

There is no transmembrane helices in MGYG000004003_02152.