CAZyme Information: MGYG000004003_02310

Basic Information

• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Bacteroides
• CAZyme ID: MGYG000004003_02310
• CAZy Family: GT19
• CAZyme Description: Lipid-A-disaccharide synthase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
378	MGYG000004003_37|CGC3	43293.37	8.3476

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000004003	5653807	MAG	United Kingdom	Europe

• Gene Location: Start: 43647; End: 44783 Strand: +

Full Sequence      

MKYYLIVGEASGDLHASHLMSALKEEDPQADFRFFGGDLMAAVGGTMVKHYKELAYMGFI
PVLLHLRTIFANMKRCKEDIVSWNPDVVILVDYPGFNLDIAKFVHAKTQIPVYYYISPKI
WAWKEYRIKNIKRDVNELFSILPFEVEFFEGKHQFPIHYVGNPTVDEVTAYQEAHPKNFA
TFVGENQLEDKPIIALLAGSRKQEIKDNLPDMLKAASAFPDYQLVLAGAPSIAPEYYKQY
MGDTKVKIIFGQTYRLLQHADAALVTSGTATLETALFRVPQVVCYHTPIGKVISFLRRHI
LTVRFISLVNLIADREVVKELVADTMTVKNMQYELKNILENEKYRSQMLKEYEYMAERLG
PAGAPRHAAREMLRLLKK

Enzyme Prediction     

No EC number prediction in MGYG000004003_02310.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT19	4	359	1.5e-114	0.9887005649717514

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK00025	lpxB	1.06e-103	1	378	2	377	lipid-A-disaccharide synthase; Reviewed
COG0763	LpxB	7.90e-93	1	378	2	381	Lipid A disaccharide synthetase [Cell wall/membrane/envelope biogenesis].
pfam02684	LpxB	3.66e-74	4	371	2	373	Lipid-A-disaccharide synthetase. This is a family of lipid-A-disaccharide synthetases, EC:2.4.2.128. These enzymes catalyze the reaction: UDP-2,3-bis(3-hydroxytetradecanoyl) glucosamine + 2,3-bis(3-hydroxytetradecanoyl)-beta-D-glucosaminyl 1-phosphate <=> UDP + 2,3-bis(3-hydroxytetradecanoyl)-D-glucosaminyl-1,6 -beta-D-2,3-bis(3-hydroxytetradecanoyl)-beta-D-glucosaminyl 1-phosphate. These enzymes catalyze the fist disaccharide step in the synthesis of lipid-A-disaccharide.
TIGR00215	lpxB	9.07e-63	5	372	10	383	lipid-A-disaccharide synthase. Lipid-A precursor biosynthesis producing lipid A disaccharide in a condensation reaction. transcribed as part of an operon including lpxA [Cell envelope, Biosynthesis and degradation of surface polysaccharides and lipopolysaccharides]
PRK14089	PRK14089	3.21e-48	1	352	2	331	lipid-A-disaccharide synthase.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QIU94431.1	2.96e-264	1	378	1	378
QQR18679.1	2.13e-257	1	378	1	378
ANU56481.1	2.13e-257	1	378	1	378
QNL40994.1	1.23e-256	1	378	1	378
QUT32803.1	2.49e-256	1	378	1	378

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5W8S_A	2.53e-35	5	375	11	380	LipidA Disaccharide Synthase (LpxB)-7 solubilizing mutations [Escherichia coli BL21(DE3)],5W8X_A Lipid A Disaccharide Synthase (LpxB)-7 solubilizing mutations-Bound to UDP [Escherichia coli BL21(DE3)]
5W8N_A	6.77e-35	5	375	11	380	LipidA Disaccharide Synthase (LpxB)-6 solubilizing mutations [Escherichia coli BL21(DE3)]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q1D393	7.35e-62	2	376	6	378	Lipid-A-disaccharide synthase OS=Myxococcus xanthus (strain DK1622) OX=246197 GN=lpxB PE=3 SV=1
Q6ALW0	7.88e-58	5	343	14	354	Lipid-A-disaccharide synthase OS=Desulfotalea psychrophila (strain LSv54 / DSM 12343) OX=177439 GN=lpxB PE=3 SV=1
Q2LVL8	4.00e-57	5	378	8	380	Lipid-A-disaccharide synthase OS=Syntrophus aciditrophicus (strain SB) OX=56780 GN=lpxB PE=3 SV=1
B3E4H8	3.32e-55	2	378	8	382	Lipid-A-disaccharide synthase OS=Trichlorobacter lovleyi (strain ATCC BAA-1151 / DSM 17278 / SZ) OX=398767 GN=lpxB PE=3 SV=1
C1F718	2.74e-54	4	364	8	376	Lipid-A-disaccharide synthase OS=Acidobacterium capsulatum (strain ATCC 51196 / DSM 11244 / BCRC 80197 / JCM 7670 / NBRC 15755 / NCIMB 13165 / 161) OX=240015 GN=lpxB PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000054	0.000001	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000004003_02310.