CAZyme Information: MGYG000004003_02410

Basic Information

• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Bacteroides
• CAZyme ID: MGYG000004003_02410
• CAZy Family: GH3
• CAZyme Description: Beta-glucosidase BoGH3B

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
731		80726.34	7.2124

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000004003	5653807	MAG	United Kingdom	Europe

• Gene Location: Start: 27080; End: 29275 Strand: +

Full Sequence      

MKKLIAYLCMMIFVLTSAAQGQTDESKMNRFVSGLMKKMTLEEKVGQLSQCSGGFATGPD
NTRISRTEDISKGLIGSLLNVSGAANTRKYQEAAMKSRLRIPLIFGLDVIHGFRTGFPLP
LAEAASFDLDAIERGSRCAAKEASAAGLHWTFAPMVDIGWDARWGRVMEGAGEDPYYGSL
VAKARVHGLQGDDLSKENTILSCIKHFAGYGASTAGKDYNSVDMSMGQFANFYMPPYKAG
VEAGAATFMSAFNDFNNEPATGSSFLLRELLKNQWGFKGFVVSDWGSVGEMINHRYAKDE
KEAAYKGIKAGLDMEMVSECYSKNLVSLVKEGKVSVKLVDDAVRRILEQKYKLGLFDDPF
RYCDEERERTVIGSEESRKEACYVAERSVVLLKNEGAVLPLSPSVKKVALVGALAKSQKD
MCGAWSCAEVSKVVTLYEAMEKRGVTVNYNDGYDLKKNQIVNLEQTLAAARQSDVVVIAM
GEQAWESGEMRSKGDISISSEQQRLVSELVKTGKPVVVLMMCGRPVIFNEVRRDAPAILC
TWWLGSEAGNAICNVLFGDYNPSGKLPMTFPQHNGQIPLYYQYKSTGRPTALGGWCAKYI
DIPTEPAYPFGYGLSYTTFEYSDVKLLPGNGNTYARVAVTVKNTGTYEGEEVVQLYVRDE
VASITRPIKELKGFDKIKLKVGESRTVTFDVKDEQLGFYNNQMKFVVEKGDFTFMVGGNS
RDLQEIKYTLN

Enzyme Prediction     

EC	3.2.1.21	3.2.1.-	3.2.1.37

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH3	94	317	1.7e-63	0.9907407407407407

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK15098	PRK15098	0.0	1	730	1	764	beta-glucosidase BglX.
COG1472	BglX	2.12e-102	39	435	1	381	Periplasmic beta-glucosidase and related glycosidases [Carbohydrate transport and metabolism].
pfam00933	Glyco_hydro_3	1.06e-86	40	348	1	315	Glycosyl hydrolase family 3 N terminal domain.
PLN03080	PLN03080	7.40e-71	35	717	56	769	Probable beta-xylosidase; Provisional
pfam01915	Glyco_hydro_3_C	1.89e-63	389	616	1	216	Glycosyl hydrolase family 3 C-terminal domain. This domain is involved in catalysis and may be involved in binding beta-glucan. This domain is found associated with pfam00933.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QIU93172.1	0.0	1	731	1	732
QUT31349.1	0.0	1	731	1	732
QRM99866.1	0.0	1	731	2	733
QDH53327.1	0.0	1	731	2	733
CBK67062.1	0.0	10	731	1	723

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5XXL_A	1.47e-213	21	730	3	751	Crystalstructure of GH3 beta-glucosidase from Bacteroides thetaiotaomicron [Bacteroides thetaiotaomicron VPI-5482],5XXL_B Crystal structure of GH3 beta-glucosidase from Bacteroides thetaiotaomicron [Bacteroides thetaiotaomicron VPI-5482],5XXM_A Crystal structure of GH3 beta-glucosidase from Bacteroides thetaiotaomicron in complex with gluconolactone [Bacteroides thetaiotaomicron VPI-5482],5XXM_B Crystal structure of GH3 beta-glucosidase from Bacteroides thetaiotaomicron in complex with gluconolactone [Bacteroides thetaiotaomicron VPI-5482]
5XXN_A	8.32e-213	21	730	3	751	CrystalStructure of mutant (D286N) beta-glucosidase from Bacteroides thetaiotaomicron in complex with sophorose [Bacteroides thetaiotaomicron VPI-5482],5XXN_B Crystal Structure of mutant (D286N) beta-glucosidase from Bacteroides thetaiotaomicron in complex with sophorose [Bacteroides thetaiotaomicron VPI-5482],5XXO_A Crystal structure of mutant (D286N) GH3 beta-glucosidase from Bacteroides thetaiotaomicron in complex with sophorotriose [Bacteroides thetaiotaomicron VPI-5482],5XXO_B Crystal structure of mutant (D286N) GH3 beta-glucosidase from Bacteroides thetaiotaomicron in complex with sophorotriose [Bacteroides thetaiotaomicron VPI-5482]
5TF0_A	8.49e-205	29	730	10	750	CrystalStructure of Glycosil Hydrolase Family 3 N-Terminal Domain Protein from Bacteroides intestinalis [Bacteroides intestinalis DSM 17393],5TF0_B Crystal Structure of Glycosil Hydrolase Family 3 N-Terminal Domain Protein from Bacteroides intestinalis [Bacteroides intestinalis DSM 17393]
6R5I_A	8.74e-180	30	730	5	732	ChainA, Periplasmic beta-glucosidase [Pseudomonas aeruginosa PAO1],6R5I_B Chain B, Periplasmic beta-glucosidase [Pseudomonas aeruginosa PAO1],6R5N_A Chain A, Periplasmic beta-glucosidase [Pseudomonas aeruginosa PAO1],6R5N_B Chain B, Periplasmic beta-glucosidase [Pseudomonas aeruginosa PAO1]
6R5P_A	4.70e-179	18	730	22	764	ChainA, Periplasmic beta-glucosidase [Pseudomonas aeruginosa PAO1],6R5P_B Chain B, Periplasmic beta-glucosidase [Pseudomonas aeruginosa PAO1]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q56078	6.21e-194	23	730	30	764	Periplasmic beta-glucosidase OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) OX=99287 GN=bglX PE=3 SV=2
P33363	7.01e-193	23	730	30	764	Periplasmic beta-glucosidase OS=Escherichia coli (strain K12) OX=83333 GN=bglX PE=3 SV=2
T2KMH0	1.68e-130	1	730	1	722	Beta-xylosidase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_22130 PE=1 SV=1
A7LXU3	1.18e-111	36	723	43	768	Beta-glucosidase BoGH3B OS=Bacteroides ovatus (strain ATCC 8483 / DSM 1896 / JCM 5824 / BCRC 10623 / CCUG 4943 / NCTC 11153) OX=411476 GN=BACOVA_02659 PE=1 SV=1
T2KMH9	8.94e-110	32	730	40	754	Putative beta-xylosidase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_22230 PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000236	0.999197	0.000149	0.000136	0.000135	0.000129

TMHMM  Annotations     

There is no transmembrane helices in MGYG000004003_02410.