CAZyme Information: MGYG000004003_02512

Basic Information

• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Bacteroides
• CAZyme ID: MGYG000004003_02512
• CAZy Family: GH115
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
984	MGYG000004003_43|CGC1	111896.37	7.6873

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000004003	5653807	MAG	United Kingdom	Europe

• Gene Location: Start: 13064; End: 16018 Strand: +

Full Sequence      

MTKLRLILWGLAVIACMPVTFGQVVLTKGNSKANEFGMINRKSNAHLYFDEQDFEVVKKA
ANLFSDDVQLVTGKKMQVEATKNKLASNSIIVGTLGHNELIDNLVARNKLDVKALENQWE
SYLIEVVRNPFPGVNKALVIVGSDRRGTAYGLFSISEIIGVSPWYWWADAPVAKHTELNL
KVDKIISKEPTVKYRGIFINDEDWGLLRWAKNTFEKERGNIGPKTYAKVCELLLRLKANY
LCPAMHEASTAFNKIPENKLVADSFAIVMGSVHCEPLLFNNASEWDKKTMGEWDYVNNKE
TLNRVLKQRVTENSLYENVYTLALRGLHDKAMGGSNDMKERVKMLGEALKDQRQLLTDVI
KKPADEIPQAFTPYKEVLDVYSAGLDLPEDVTIIWPDDNYGYMKRLSSPREQKRSGRAGV
YYHVSYLGKPHDYLWMSTTPPALMYEELRKAYDATADRIWLLNVGDIKSCESSMDLFLTM
AYDIDSFNYDNISLYQARWLSKMFGNRYYDDFVDITNTFYHQAFSRKPEFMGWGYQWSTN
RHGKERNTDTDFSFANYQEADSRLAAYDRIGAKVERILSELPEEQKAGFYQLLYYPVKGC
ELMNKMVLNGQKNRWYALQQRAAANELKNQVKVYYDSLQTITQGYNSLLNGKWNHIMTTR
QGFAASYFELPKLETVTLSNTPSLGVWVEGEDVLKGKSSFHMLPVFNTYLRQPYFFDVFN
KGKGSLNWNIKTSENWIQVNKEKGSTASEDRIWVSVDWTKVQSGERISGMIEVTADGVGK
ENIYVSVFNPSSPSLTEMDTLFVEHNGYVSINAADYHRKVENDAIKIMTIPNLGFENASV
QLGNPIAPMQRTGSSIVPRVEYDFYTFGQGSVDVYTYVLPTFTLSADKGYAGHEATNIET
RYGVCIDDGPVMNPSTSSFEYAQIWYESALKNCRINKTTLHINKPGKHTIKVLCGDAGTV
LQKVVLDFGGMKRSYLGPKPTKAK

Enzyme Prediction     

No EC number prediction in MGYG000004003_02512.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH115	34	668	3.6e-225	0.8335724533715926

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam15979	Glyco_hydro_115	4.80e-161	188	530	1	334	Glycosyl hydrolase family 115. Glyco_hydro_115 is a family of glycoside hydrolases likely to have the activity of xylan a-1,2-glucuronidase, EC:3.2.1.131, or a-(4-O-methyl)-glucuronidase EC:3.2.1.-.
pfam17829	GH115_C	4.68e-51	802	980	2	172	Gylcosyl hydrolase family 115 C-terminal domain. This domain is found at the C-terminus of glycosyl hydrolase family 115 proteins. This domain has a beta-sandwich fold.
pfam03648	Glyco_hydro_67N	0.002	76	153	50	118	Glycosyl hydrolase family 67 N-terminus. Alpha-glucuronidases, components of an ensemble of enzymes central to the recycling of photosynthetic biomass, remove the alpha-1,2 linked 4-O-methyl glucuronic acid from xylans. This family represents the N-terminal region of alpha-glucuronidase. The N-terminal domain forms a two-layer sandwich, each layer being formed by a beta sheet of five strands. A further two helices form part of the interface with the central, catalytic, module (pfam07488).

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QUR45612.1	0.0	1	984	1	984
QUT89091.1	0.0	1	982	1	983
ALJ59884.1	0.0	1	982	1	983
EDV06188.1	0.0	7	982	7	983
QDO71503.1	0.0	7	982	5	981

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4ZMH_A	3.87e-163	45	981	23	933	Crystalstructure of a five-domain GH115 alpha-Glucuronidase from the Marine Bacterium Saccharophagus degradans 2-40T [Saccharophagus degradans 2-40],4ZMH_B Crystal structure of a five-domain GH115 alpha-Glucuronidase from the Marine Bacterium Saccharophagus degradans 2-40T [Saccharophagus degradans 2-40]
5BY3_A	7.89e-135	56	654	39	612	Anovel family GH115 4-O-Methyl-alpha-glucuronidase, BtGH115A, with specificity for decorated arabinogalactans [Bacteroides thetaiotaomicron VPI-5482]
4C90_A	8.18e-113	34	657	42	640	Evidencethat GH115 alpha-glucuronidase activity is dependent on conformational flexibility [Bacteroides ovatus],4C90_B Evidence that GH115 alpha-glucuronidase activity is dependent on conformational flexibility [Bacteroides ovatus],4C91_A Evidence that GH115 alpha-glucuronidase activity is dependent on conformational flexibility [Bacteroides ovatus],4C91_B Evidence that GH115 alpha-glucuronidase activity is dependent on conformational flexibility [Bacteroides ovatus]
6NPS_A	3.50e-110	35	981	10	963	Crystalstructure of GH115 enzyme AxyAgu115A from Amphibacillus xylanus [Amphibacillus xylanus NBRC 15112],6NPS_B Crystal structure of GH115 enzyme AxyAgu115A from Amphibacillus xylanus [Amphibacillus xylanus NBRC 15112]
7PUG_A	4.26e-97	36	661	17	629	ChainA, xylan alpha-1,2-glucuronidase [uncultured bacterium]

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.001035	0.935977	0.062242	0.000272	0.000245	0.000232

TMHMM  Annotations     

start	end
7	26