CAZyme Information: MGYG000004003_02525

Basic Information

• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Bacteroides
• CAZyme ID: MGYG000004003_02525
• CAZy Family: GH146
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
653	MGYG000004003_43|CGC1	75085.62	8.6766

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000004003	5653807	MAG	United Kingdom	Europe

• Gene Location: Start: 38367; End: 40328 Strand: +

Full Sequence      

MDRVNHNRMVKRLFMVLSGWVMGGTLAFSQNQPTAIVQKEAYFPMKEVRLLDSPFQTLQQ
KGKEYLLWLNPDSLLHFYRIEAGLPSKAEAYAGWESQDVWGAGPLRGGFLGFYLSSVSMM
YQSTGDKELLRRLKYVLKELELCQETGKDGFLLGVKDGRKLFREVASGKIKTSNPTVNGV
WAPVYLINKMLLGLAAAYTQCDLKEALPILIRLADWFGYQVLDKLTDEQIQQLLVCEHGS
INGSYVEAYELTGQKRFLDWALRLNDRAMWVPLSEGKDILFGWHANTQIPKFTGFHKYYM
FTGDQRFLAAATNFWDIVKQNHTWVIGGNSTGEHFFSKKEFIERMLHISGPETCNSVNML
RLTESLFSQQPDATKAAYYERTLFNHILSAYDPVKGMCCYFTSMRPGHYRIYASRDSSFW
CCGHTGLESPAKLGKFIYSHRVTDVHEEKEIRVNLFIPSVLSWHEGGVELIQRNRIPESE
QVDFALNLKKKQKLVLRVRKPDWTDKATFMINGKEEEPLLGSDGYWIIDRVWERKNVITL
RLPMHIYTENLIGTDRYVALLYGPYVLAGRMGTENMPATFWGKMNNTAMNEIDMAKIPAF
RESAGQIPAHVKAVLEGNTLKFGINMKGFENIVLEPFYKVHFERYAVYWPIVH

Enzyme Prediction     

No EC number prediction in MGYG000004003_02525.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH146	47	568	2.3e-170	0.9980119284294234

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam07944	Glyco_hydro_127	0.0	47	568	1	503	Beta-L-arabinofuranosidase, GH127. One member of this family, from Bidobacterium longicum, UniProtKB:E8MGH8, has been characterized as an unusual beta-L-arabinofuranosidase enzyme, EC:3.2.1.185. It rleases l-arabinose from the l-arabinofuranose (Araf)-beta1,2-Araf disaccharide and also transglycosylates 1-alkanols with retention of the anomeric configuration. Terminal beta-l-arabinofuranosyl residues have been found in arabinogalactan proteins from a mumber of different plantt species. beta-l-Arabinofuranosyl linkages with 1-4 arabinofuranosides are also found in the sugar chains of extensin and solanaceous lectins, hydroxyproline (Hyp)2-rich glycoproteins that are widely observed in plant cell wall fractions. The critical residue for catalytic activity is Glu-338, in a ET/SCAS sequence context.
COG3533	COG3533	3.34e-99	46	613	10	540	Uncharacterized conserved protein, DUF1680 family [Function unknown].
pfam16375	DUF4986	3.05e-17	572	649	1	84	Domain of unknown function. This family around 150 residues locates in the C-terminal of some uncharacterized proteins in various Bacteroides and Bacillus species. The function of this family remains unknown.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QUU06683.1	0.0	40	653	43	655
QQT79801.1	0.0	40	653	43	655
ASM67761.1	0.0	40	653	43	655
QRP59750.1	0.0	40	653	43	655
QUR45626.1	0.0	9	650	2	644

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6YQH_AAA	6.42e-128	41	649	26	648	ChainAAA, Acetyl-CoA carboxylase, biotin carboxylase [Bacteroides thetaiotaomicron VPI-5482]
5OPJ_A	1.04e-121	41	649	26	648	Beta-L-arabinofuranosidase[Bacteroides thetaiotaomicron]
6EX6_A	5.05e-10	114	544	76	517	TheGH127, Beta-arabinofuranosidase, BT3674 [Bacteroides thetaiotaomicron VPI-5482],6EX6_B The GH127, Beta-arabinofuranosidase, BT3674 [Bacteroides thetaiotaomicron VPI-5482]

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.046135	0.946818	0.005700	0.000731	0.000311	0.000264

TMHMM  Annotations     

start	end
13	35