CAZyme Information: MGYG000004003_02569

Basic Information

• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Bacteroides
• CAZyme ID: MGYG000004003_02569
• CAZy Family: GH105
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
469		53066.56	6.6358

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000004003	5653807	MAG	United Kingdom	Europe

• Gene Location: Start: 41406; End: 42815 Strand: -

Full Sequence      

MNIRIIAIASLLIALPVSAQKKKTVVNDSNTPLHLLQPAYQGTYGDLTPEQVKKEVDRVF
AYIDKETPARVVDKNTGKVITDYTTMGEEAQLERGAFRLASYEWGVTYSALIAASEATGD
IRYMDYVQNRFRFLAEVAPHFKRVYKEKGTTDPQLLQILTPHALDDAGAVCAAMVKVRLK
DPSLPVDELIRNYFDFIINKEYRLADGTFARNRPQHNTLWLDDMFMGIPAVAQMSYYDKE
QKDKYLAEAVRQFLQFADRMFIPEKGLYRHGWVESSSDHPAFCWARANGWAMLTACELLD
VLPEDYPQRAKVMDYFRAHVRGVTALQSGEGLWHQLLDRNDSYLETSATAIYVYCLAHAI
NKGWIDAIAYGPVAHLGWHAVAGKINAEGQVEGTCVGTGMAFDPAFYYYRPVNVYAAHGY
GPVLWAGAEMIRLLKNQYPKMNDSAVQYYQVKQKTTAPIFAIDTEEKKD

Enzyme Prediction     

EC	3.2.1.172

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH105	96	432	3.2e-91	0.9728915662650602

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam07470	Glyco_hydro_88	3.85e-105	62	434	1	343	Glycosyl Hydrolase Family 88. Unsaturated glucuronyl hydrolase catalyzes the hydrolytic release of unsaturated glucuronic acids from oligosaccharides (EC:3.2.1.-) produced by the reactions of polysaccharide lyases.
COG4225	YesR	1.81e-47	102	434	36	357	Rhamnogalacturonyl hydrolase YesR [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QDH54531.1	0.0	1	469	1	469
QQR18601.1	0.0	1	469	1	469
ANU56551.1	0.0	1	469	1	469
QRM98496.1	0.0	1	469	1	469
QUT32921.1	0.0	1	469	1	469

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3K11_A	5.28e-304	22	465	2	445	Crystalstructure of Putative glycosyl hydrolase (NP_813087.1) from BACTEROIDES THETAIOTAOMICRON VPI-5482 at 1.80 A resolution [Bacteroides thetaiotaomicron VPI-5482]
3QWT_A	5.54e-22	216	413	163	360	ChainA, Putative GH105 family protein [Salmonella enterica subsp. enterica serovar Paratyphi A],3QWT_B Chain B, Putative GH105 family protein [Salmonella enterica subsp. enterica serovar Paratyphi A],3QWT_C Chain C, Putative GH105 family protein [Salmonella enterica subsp. enterica serovar Paratyphi A],3QWT_D Chain D, Putative GH105 family protein [Salmonella enterica subsp. enterica serovar Paratyphi A]
1NC5_A	3.45e-20	102	436	41	370	Structureof Protein of Unknown Function of YteR from Bacillus Subtilis [Bacillus subtilis],2D8L_A Crystal Structure of Unsaturated Rhamnogalacturonyl Hydrolase in complex with dGlcA-GalNAc [Bacillus subtilis]
3PMM_A	1.25e-19	216	413	164	361	ChainA, Putative cytoplasmic protein [Klebsiella pneumoniae subsp. pneumoniae MGH 78578]
2GH4_A	1.39e-19	102	436	31	360	ChainA, Putative glycosyl hydrolase yteR [Bacillus subtilis]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
O34559	1.89e-19	102	436	41	370	Unsaturated rhamnogalacturonyl hydrolase YteR OS=Bacillus subtilis (strain 168) OX=224308 GN=yteR PE=1 SV=1
P9WF04	1.71e-17	220	431	201	409	Unsaturated 3S-rhamnoglycuronyl hydrolase OS=Alteromonas sp. (strain LOR) OX=1537994 GN=LOR_28 PE=1 SV=1
O31521	1.35e-16	101	438	28	343	Unsaturated rhamnogalacturonyl hydrolase YesR OS=Bacillus subtilis (strain 168) OX=224308 GN=yesR PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000721	0.988164	0.010482	0.000208	0.000217	0.000199

TMHMM  Annotations     

There is no transmembrane helices in MGYG000004003_02569.