CAZyme Information: MGYG000004003_02640

Basic Information

• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Bacteroides
• CAZyme ID: MGYG000004003_02640
• CAZy Family: GH76
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
464	MGYG000004003_47|CGC1	52059.09	4.4691

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000004003	5653807	MAG	United Kingdom	Europe

• Gene Location: Start: 14044; End: 15438 Strand: +

Full Sequence      

MKNYIVSFSKKALLLGGVTLTMFAACDDGELSDIYKGSSSGEYVSDVNWTDAANTSTETY
IKYFFENAGGRDTFCGSIYWEKPNTPETGEPTSTGGSGGWSQGHALDIVIDAYIRHADDP
AYQADLYENIMKPFLPAFDDWNEHCGYGGKDFWNNFYDDMEWMALACLRVYELTGDEDYY
SALMKMWDHIKGAKNDYKGVGGMAWKTDAPASRMACSNGPGCLLAMKLYKLTVKEAKEGW
EDKAAYYLNFAKEVYNWMTAYLCDTSTGQVYDNLGIKDDGTPGDPDKVALSYNQGTFMAS
ALALYNATGEEEYLRNAVAFGSYQVNKKMDSNYPVFSGEGNSGDNLLFRGIFVRYFLDMV
KQPVSSVYPEKTRNKFIAALRSCSDVLWTLAHPEGYYVWEYDWAKAPKFGNRDNREDRLT
ISLNAEVPGATMIEIRARYEDWVQGKASEEANWVGPEFGKKAGE

Enzyme Prediction     

No EC number prediction in MGYG000004003_02640.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH76	52	409	5.4e-71	0.9134078212290503

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG4833	COG4833	1.64e-25	49	444	3	357	Predicted alpha-1,6-mannanase, GH76 family [Carbohydrate transport and metabolism].
pfam03663	Glyco_hydro_76	3.28e-25	51	384	4	318	Glycosyl hydrolase family 76. Family of alpha-1,6-mannanases.
pfam07221	GlcNAc_2-epim	0.004	166	323	148	307	N-acylglucosamine 2-epimerase (GlcNAc 2-epimerase). This family contains a number of eukaryotic and bacterial N-acylglucosamine 2-epimerase (GlcNAc 2-epimerase) enzymes (EC:5.3.1.8) approximately 500 residues long. This converts N-acyl-D-glucosamine to N-acyl-D-mannosamine.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QIU94027.1	0.0	1	464	1	463
QRQ55352.1	0.0	1	464	1	463
SCV07928.1	0.0	1	464	1	463
QUT32576.1	0.0	1	464	1	463
QDM11364.1	0.0	1	464	1	463

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6SHD_A	2.41e-44	100	376	89	337	Structureof the GH76A alpha-1,6-mannanase from Salegentibacter sp. HEL1_6 [Salegentibacter sp. Hel_I_6],6SHD_B Structure of the GH76A alpha-1,6-mannanase from Salegentibacter sp. HEL1_6 [Salegentibacter sp. Hel_I_6],6SHD_C Structure of the GH76A alpha-1,6-mannanase from Salegentibacter sp. HEL1_6 [Salegentibacter sp. Hel_I_6]
6Y8F_A	6.63e-43	100	376	90	338	ChainA, Alpha-1,6-endo-mannanase GH76A mutant [Salegentibacter sp. Hel_I_6]
6SHM_A	4.76e-42	100	376	90	338	Aninactive (D136A and D137A) variant of alpha-1,6-mannanase, GH76A of Salegentibacter sp. HEL1_6 in complex with alpha-1,6-mannotetrose [Salegentibacter sp. Hel_I_6]
3K7X_A	6.77e-30	49	440	3	341	ChainA, Lin0763 protein [Listeria innocua]
4BOK_A	3.62e-28	100	404	39	318	ChainA, Alpha-1,6-mannanase [Niallia circulans]

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as LIPO

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000002	0.000025	1.000060	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000004003_02640.