CAZyme Information: MGYG000004003_02646

Basic Information

• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Bacteroides
• CAZyme ID: MGYG000004003_02646
• CAZy Family: GH105
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
370	MGYG000004003_47|CGC1	42716	6.8359

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000004003	5653807	MAG	United Kingdom	Europe

• Gene Location: Start: 29360; End: 30472 Strand: +

Full Sequence      

MRNYVILFSTCLLLLFFTGCNMITQKKEKATGEIYNETFIKDIMLKVARWQVAHPDSLND
WQEQWARSVFYSGVMYAYNATQDTTYLNQALRWGEGWGWKRGPKFRHADDLACGQAYLDA
YAVVRREEMLNGIKMSIDSLIADPKPGRVDWWWCDALFMEPPVLVRLGKLTGDEKYYSYL
HDMYWDTTDFLYSKPDSLFYRDKNYFNAMTANGKKSFWSRGNAWVLGGLAQILAMMNKKH
PDYPKYEELYLQMIHKIAPLQQGDGLWRPSLLDPDDIPVKETSGSTFFTYALAWGVNNGL
LDKEIFLPQVKKGWQGLVESVNHEGKLGYVQLIGAKPEKVEIGHNQEYGSGAFLMAASEM
LKLEKEEKVK

Enzyme Prediction     

No EC number prediction in MGYG000004003_02646.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH105	62	362	1.2e-78	0.963855421686747

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam07470	Glyco_hydro_88	5.97e-76	46	363	4	342	Glycosyl Hydrolase Family 88. Unsaturated glucuronyl hydrolase catalyzes the hydrolytic release of unsaturated glucuronic acids from oligosaccharides (EC:3.2.1.-) produced by the reactions of polysaccharide lyases.
COG4225	YesR	1.97e-60	59	364	32	357	Rhamnogalacturonyl hydrolase YesR [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QIU94033.1	3.86e-269	22	370	1	349
QBH99511.1	3.31e-97	44	363	54	380
QGZ39939.1	2.84e-96	46	363	47	371
BBE17072.1	1.37e-95	9	365	17	380
ADW71258.1	4.21e-94	40	363	87	410

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4CE7_A	1.12e-75	24	363	13	369	Crystalstructure of a novel unsaturated beta-glucuronyl hydrolase enzyme, belonging to family GH105, involved in ulvan degradation [Nonlabens ulvanivorans],4CE7_B Crystal structure of a novel unsaturated beta-glucuronyl hydrolase enzyme, belonging to family GH105, involved in ulvan degradation [Nonlabens ulvanivorans],4CE7_C Crystal structure of a novel unsaturated beta-glucuronyl hydrolase enzyme, belonging to family GH105, involved in ulvan degradation [Nonlabens ulvanivorans]
5NOA_A	1.54e-57	19	362	21	373	PolysaccharideLyase BACCELL_00875 [Bacteroides thetaiotaomicron]
4Q88_A	1.90e-46	24	362	4	356	ChainA, Uncharacterized protein [Phocaeicola vulgatus ATCC 8482],4Q88_B Chain B, Uncharacterized protein [Phocaeicola vulgatus ATCC 8482]
1NC5_A	1.66e-11	67	360	43	364	Structureof Protein of Unknown Function of YteR from Bacillus Subtilis [Bacillus subtilis],2D8L_A Crystal Structure of Unsaturated Rhamnogalacturonyl Hydrolase in complex with dGlcA-GalNAc [Bacillus subtilis]
2GH4_A	6.82e-11	67	360	33	354	ChainA, Putative glycosyl hydrolase yteR [Bacillus subtilis]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
T2KPL9	3.37e-76	36	364	30	376	Unsaturated 3S-rhamnoglycuronyl hydrolase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_22220 PE=2 SV=1
L7P9J4	7.50e-75	24	363	20	376	Unsaturated 3S-rhamnoglycuronyl hydrolase OS=Nonlabens ulvanivorans OX=906888 GN=IL45_01505 PE=1 SV=1
P9WF04	7.49e-60	37	361	54	409	Unsaturated 3S-rhamnoglycuronyl hydrolase OS=Alteromonas sp. (strain LOR) OX=1537994 GN=LOR_28 PE=1 SV=1
O34559	9.10e-11	67	360	43	364	Unsaturated rhamnogalacturonyl hydrolase YteR OS=Bacillus subtilis (strain 168) OX=224308 GN=yteR PE=1 SV=1
O31521	3.41e-10	60	365	26	340	Unsaturated rhamnogalacturonyl hydrolase YesR OS=Bacillus subtilis (strain 168) OX=224308 GN=yesR PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as LIPO

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000000	0.000000	1.000064	0.000000	0.000000	0.000000

TMHMM  Annotations     

start	end
5	24