CAZyme Information: MGYG000004003_02671

Basic Information

• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Bacteroidaceae; Bacteroides
• CAZyme ID: MGYG000004003_02671
• CAZy Family: GH3
• CAZyme Description: Beta-hexosaminidase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
1182	MGYG000004003_48|CGC1	132956.15	6.5532

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000004003	5653807	MAG	United Kingdom	Europe

• Gene Location: Start: 12792; End: 16340 Strand: -

Full Sequence      

MNRILTILVCLTATCCIHAQGGKNEKMDRFIDQLISKMTLEEKIGQLNLPSAGDITTGQA
TSSNIADKIRKGQVGGLFNIKGVTKIRDVQRIAVEESRLKIPLLFGMDVIHGYETAFPIP
LGLAATWNMEAIEQSARIAAIEASADGICWTFSPMVDISQDARWGRVSEGNGEDPFLGGE
IAKAMVRGYQGDNSYTSNNHIMACVKHYALYGAGFAGRDYNTVDMSRIRMFNEYMYPYKA
AIEAGVGSVMASFNEVDGVPATANKWLMTDILRKQWKFDGFVVTDYTGISEMVPHGIGDL
PTVSARALKAGIDMDMVSEGFLTTLAQSLKENKVNVEEIDQACRRILEAKYKLGLFDNPY
KFCDPDRPAKEIYTRESREIARKIAAESFVLLKNQQEVLPLKKSGKIAVIGPLANTRSNM
PGTWSVAVDLNKPMTLVEGIREVAGKDTRVFYAKGSNLTADPELEKRATMFGRELGRDNR
TDKELLNEALKVARQSDVIVAALGESSEMSGESSSRTDLNIPDVQKELLAELAKTGKPVV
LVVFTGRPLTLTWEEKHIPAILNVWFGGTEAAPAIADVLFGDVNPSGKLTMSFPQNVGQS
PLFYNHKNTGRPLEEGKWFEKFRSNYLDVSNDPLYPFGFGLSYTQFEYSNLQLSHSQLRT
DGELTATVTLTNTGKRDGQETVQLYIRDVVGSVTRPVKELKGFQKVFLKAGESKNISFKI
TPELLKFYNYDLDYVYEPGEFHVMIGGNSRDTKMATFTLQEEEKISEEALLDSVQRRTFD
YFWNGAEPMSGMARERLNVDGNYPLNDRHIITSGGSGFGIMAIIAGIERNYVTRAEGFAR
MEKIVSFLERADKFHGAFPHWWDGETGKIKPFGPKDDGGDLVETAFLVQGLLAAHQYYVN
GNKEERELAARMDKLWRNVDWNWYRNKENVLFWHWSPEHQWDMNFRVRGFNECLIMYILA
AASPTHGVPAKVYHEGWAENGAIVKPHTAENLPMNLRYQTGSIGPLFWAHYSFLGLDPNG
LKDQYANYFDEMKNYTLANRAYCIRNPKNYKGYGENCWGLTASYSVKGYAAHAPNEKEDH
GVISPTAALSSIVYTPEESMDVMKYLYQKKNKTWGEYGFYDAFSETENWYPQQYLAIDQG
PVAVMIENYRSQLLWKLFMQHPDVRKGLRKLGFSSPHLDKKK

Enzyme Prediction     

EC	3.2.1.71

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH144	764	1174	1.8e-189	0.9925742574257426
GH3	95	317	8e-70	0.9861111111111112

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK15098	PRK15098	0.0	28	760	35	765	beta-glucosidase BglX.
pfam00933	Glyco_hydro_3	1.05e-113	39	349	1	316	Glycosyl hydrolase family 3 N terminal domain.
COG1472	BglX	6.06e-105	38	426	1	373	Periplasmic beta-glucosidase and related glycosidases [Carbohydrate transport and metabolism].
pfam10091	Glycoamylase	3.03e-104	944	1162	1	215	Putative glucoamylase. The structure of UniProt:Q5LIB7 has an alpha/alpha toroid fold and is similar structurally to a number of glucoamylases. Most of these structural homologs are glucoamylases, involved in breaking down complex sugars (e.g. starch). The biologically relevant state is likely to be monomeric. The putative active site is located at the centre of the toroid with a well defined large cavity.
COG5368	COG5368	2.53e-96	766	1173	9	430	Uncharacterized protein [Function unknown].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QDO67944.1	0.0	17	1174	22	1186
QIK58695.1	0.0	1	759	1	760
QIK53277.1	0.0	1	759	1	760
AIA99602.1	0.0	8	759	9	762
AFH08280.1	0.0	8	759	9	762

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5XXN_A	0.0	25	762	8	754	CrystalStructure of mutant (D286N) beta-glucosidase from Bacteroides thetaiotaomicron in complex with sophorose [Bacteroides thetaiotaomicron VPI-5482],5XXN_B Crystal Structure of mutant (D286N) beta-glucosidase from Bacteroides thetaiotaomicron in complex with sophorose [Bacteroides thetaiotaomicron VPI-5482],5XXO_A Crystal structure of mutant (D286N) GH3 beta-glucosidase from Bacteroides thetaiotaomicron in complex with sophorotriose [Bacteroides thetaiotaomicron VPI-5482],5XXO_B Crystal structure of mutant (D286N) GH3 beta-glucosidase from Bacteroides thetaiotaomicron in complex with sophorotriose [Bacteroides thetaiotaomicron VPI-5482]
5TF0_A	0.0	28	760	10	751	CrystalStructure of Glycosil Hydrolase Family 3 N-Terminal Domain Protein from Bacteroides intestinalis [Bacteroides intestinalis DSM 17393],5TF0_B Crystal Structure of Glycosil Hydrolase Family 3 N-Terminal Domain Protein from Bacteroides intestinalis [Bacteroides intestinalis DSM 17393]
5XXL_A	0.0	25	762	8	754	Crystalstructure of GH3 beta-glucosidase from Bacteroides thetaiotaomicron [Bacteroides thetaiotaomicron VPI-5482],5XXL_B Crystal structure of GH3 beta-glucosidase from Bacteroides thetaiotaomicron [Bacteroides thetaiotaomicron VPI-5482],5XXM_A Crystal structure of GH3 beta-glucosidase from Bacteroides thetaiotaomicron in complex with gluconolactone [Bacteroides thetaiotaomicron VPI-5482],5XXM_B Crystal structure of GH3 beta-glucosidase from Bacteroides thetaiotaomicron in complex with gluconolactone [Bacteroides thetaiotaomicron VPI-5482]
6R5I_A	2.22e-232	28	759	4	732	ChainA, Periplasmic beta-glucosidase [Pseudomonas aeruginosa PAO1],6R5I_B Chain B, Periplasmic beta-glucosidase [Pseudomonas aeruginosa PAO1],6R5N_A Chain A, Periplasmic beta-glucosidase [Pseudomonas aeruginosa PAO1],6R5N_B Chain B, Periplasmic beta-glucosidase [Pseudomonas aeruginosa PAO1]
6R5O_A	1.24e-231	28	759	4	732	ChainA, Periplasmic beta-glucosidase [Pseudomonas aeruginosa PAO1],6R5O_B Chain B, Periplasmic beta-glucosidase [Pseudomonas aeruginosa PAO1],6R5R_B Chain B, Periplasmic beta-glucosidase [Pseudomonas aeruginosa PAO1],6R5T_A Chain A, Periplasmic beta-glucosidase [Pseudomonas aeruginosa PAO1],6R5T_B Chain B, Periplasmic beta-glucosidase [Pseudomonas aeruginosa PAO1],6R5U_A Chain A, Periplasmic beta-glucosidase [Pseudomonas aeruginosa PAO1],6R5U_B Chain B, Periplasmic beta-glucosidase [Pseudomonas aeruginosa PAO1],6R5V_A Chain A, Periplasmic beta-glucosidase [Pseudomonas aeruginosa PAO1],6R5V_B Chain B, Periplasmic beta-glucosidase [Pseudomonas aeruginosa PAO1]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P33363	5.63e-230	25	759	32	764	Periplasmic beta-glucosidase OS=Escherichia coli (strain K12) OX=83333 GN=bglX PE=3 SV=2
Q56078	1.25e-228	25	759	32	764	Periplasmic beta-glucosidase OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) OX=99287 GN=bglX PE=3 SV=2
T2KMH0	2.13e-136	61	759	25	720	Beta-xylosidase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_22130 PE=1 SV=1
A6LGF6	3.87e-127	765	1171	299	717	Exo beta-1,2-glucooligosaccharide sophorohydrolase (non-reducing end) OS=Parabacteroides distasonis (strain ATCC 8503 / DSM 20701 / CIP 104284 / JCM 5825 / NCTC 11152) OX=435591 GN=BDI_3064 PE=1 SV=1
T2KMH9	4.32e-119	31	761	40	756	Putative beta-xylosidase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_22230 PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000253	0.999074	0.000199	0.000156	0.000161	0.000150

TMHMM  Annotations     

There is no transmembrane helices in MGYG000004003_02671.